KEGG   Mycoplasma capricolum subsp. capricolum ATCC 27343: MCAP_0143Help
Entry
MCAP_0143         CDS       T00309                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mcp  Mycoplasma capricolum subsp. capricolum ATCC 27343
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MCAP_0143 (tdk)
Enzymes [BR:mcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MCAP_0143 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
172616..173245
Genome map
AA seq 209 aa AA seqDB search
MTELDINEIEAYNSNKMGWIELITGCMFAGKTEEFIRRLKVLSYAKKRVLAFKPSIDNRY
SVENIISHSGSKLDSYLVKSSDEIKQIVEKENQIQQVDVIGIDEVQFFDENVVDIIEQLA
DNGIIVIVNGLDKDFRGLPFKNVDKLLVKAEFVTKLRARCHLCGSFANRSQRIVNGQPAL
WDSPLILVDGKESYEARCRKCFISPKKDV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattagatattaatgaaatagaagcatataattctaataaaatgggttgaatt
gagctaattacaggttgtatgtttgctggaaaaactgaagaatttataagacgcttaaaa
gttttaagttatgctaaaaaaagagtattagcttttaaaccaagtattgataatagatat
tcagttgaaaatataatttcacattcaggaagtaaattagattcttatttagtaaaatca
agtgatgagattaaacaaatagttgaaaaagaaaatcaaattcaacaagttgatgtgata
ggaattgatgaagtacaattttttgatgaaaatgttgttgatataattgaacaactagca
gataatggaataattgtaattgttaatggattagataaagactttagagggttaccattt
aaaaatgtagataaattactagtaaaagcagaatttgtaactaagttaagagcaagatgt
catttatgtggatcttttgcaaatagatctcaaagaattgttaatggacaacctgcttta
tgagattctcctttaattctagttgatggtaaagaaagttatgaagcaagatgtagaaaa
tgctttatatctcctaaaaaggatgtgtaa

DBGET integrated database retrieval system