KEGG   Mycoplasma capricolum: MCAP_0208Help
Entry
MCAP_0208         CDS       T00309                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mcp  Mycoplasma capricolum
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MCAP_0208 (gmk)
Enzymes [BR:mcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MCAP_0208 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
250997..251890
Genome map
AA seq 297 aa AA seqDB search
MKKGKMIIISGPSGVGKGSVNGELLQNPDLRLKYSVSMTTRKPRNGEINGVNYFFVSNEE
FAKAIVNDELIEYAHFVGNSYGTPRKYVEQELKKGNNVILEIEVDGATQVLNKEANVLSI
FLMPPNLTELANRIRGRQTEDEEKIKARLDKALLEIPLKHNYQYVIENDNVANAVAKITD
VLHLEGLTDIKTPTVYERLEQIVEQIVKEKYMYFVNNWETNVKLLAKNEEEKNKAKNFDA
ETYLIKLLTKKVYHKVLGHGDFSKLLDKDFVDFKIQKLMFKINFFSVEQKHYNNDEF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtaaaatgatcataatttcaggaccaagtggagttggtaaaggttcagtt
aatggagaacttttacaaaatccagacctacgtttgaaatattcagtttcaatgacaaca
agaaaacctagaaatggtgaaattaatggagtaaactatttttttgtttcaaatgaagaa
tttgcaaaggccattgttaatgatgaattaattgagtatgcacattttgttggtaattct
tatggtactcctagaaaatatgttgaacaagaattaaaaaaaggtaataatgttatttta
gaaattgaagtagatggggctactcaagttttaaataaagaagcaaatgttttatctatt
tttttaatgcctccaaatctaactgaattagctaatagaattagaggaagacaaactgaa
gatgaagaaaaaataaaagcacgactagataaagctttattagaaattcctttaaaacac
aattatcaatatgtaattgaaaatgataatgtagctaatgctgttgctaaaattactgat
gttttacatttagaaggtttaactgatataaaaactccaactgtatatgaaagattagaa
caaattgttgaacaaattgttaaagaaaaatatatgtattttgttaataattgagaaact
aatgttaaattattagctaaaaatgaagaagaaaaaaataaagctaaaaactttgatgct
gaaacttatttaattaaattattaactaaaaaggtgtatcacaaagttttaggacatggt
gatttttctaaattactagataaagattttgttgattttaaaattcaaaaattaatgttt
aaaattaatttctttagtgttgaacaaaaacattataataacgatgaattctag

DBGET integrated database retrieval system