KEGG   Mycoplasma capricolum: MCAP_0220Help
Entry
MCAP_0220         CDS       T00309                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcp  Mycoplasma capricolum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCAP_0220 (pfkA)
   01230 Biosynthesis of amino acids
    MCAP_0220 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCAP_0220 (pfkA)
   00030 Pentose phosphate pathway
    MCAP_0220 (pfkA)
   00051 Fructose and mannose metabolism
    MCAP_0220 (pfkA)
   00052 Galactose metabolism
    MCAP_0220 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MCAP_0220 (pfkA)
Enzymes [BR:mcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MCAP_0220 (pfkA)
Protein phosphatases and associated proteins [BR:mcp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MCAP_0220 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
264143..265123
Genome map
AA seq 326 aa AA seqDB search
MIKKIGILTSGGDAPGMNNAIAGVVKTASSKGIEVYGINDGYKGLVNGWFEKLNVEKTLD
ILSRGGTYLGSARLPEFKELEVRQKAVANLKKAGIEALVVIGGDGSYMGAQRLTEMGINC
IGLPGTIDNDIASTDYTIGFHTALNTIVEAVDRIRDTMQSHNRADVVEIMGNGCGDLVTY
TAVATGAEIFSPAEDLLTIEQMGQKAKQFRLLGKKSLIILVSEKLYGISAEEIAEKIQKI
SGYETKATVLGHIQRGGRPTAMDRYIAFTAGMFAVEKLAEGKGGLFIGLENNKLVARDID
STLNMKKEDKKPFIKNLREINGHFSK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaatcggaattttaacttctggtggtgatgctcctggaatgaataatgcc
attgctggagttgtaaaaacagcttcttcaaaaggtattgaagtatatgggattaatgat
ggatataaaggattagtaaatggttgatttgaaaaactaaatgttgaaaaaactttagat
attctttcaaggggtggaacttatttaggttcagcaagactacctgaatttaaagaatta
gaagtaagacaaaaagctgtagcaaatcttaaaaaggctggaattgaagctttagttgta
attggtggagatggtagttatatgggtgctcaaagattaactgaaatgggtattaattgt
atagggctacctggaactattgataatgatattgcttcaactgattatactattggtttt
catactgcactaaatacaattgttgaagcagttgatagaattagagatacaatgcaatca
cataatagagcagatgttgttgaaattatgggaaatggttgcggtgatttggtaacttat
acagcagttgctacaggagctgagatattttctccagctgaagatttattaacaattgaa
caaatgggtcaaaaagcaaaacaatttagattattaggtaaaaaaagtttaattatttta
gtttcagaaaagttatatggaatatctgctgaagaaattgctgaaaagattcaaaaaatt
agtggttatgaaactaaagcaactgttttaggacatattcaacgtggtggtagaccaact
gctatggatagatatatagcttttacagctggtatgtttgctgttgaaaaactagctgaa
ggtaaaggtggattatttataggattagaaaataataaactagttgcaagagatattgat
tcaactttaaatatgaaaaaagaagataaaaaaccttttattaaaaatttaagagaaatt
aatggacattttagcaaataa

DBGET integrated database retrieval system