KEGG   Mycoplasma capricolum: MCAP_0429Help
Entry
MCAP_0429         CDS       T00309                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mcp  Mycoplasma capricolum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mcp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(515351..515911)
Genome map
AA seq 186 aa AA seqDB search
MNDYINGFLYKIDDKFLYLELNYLGYRYLYLKSDLKNFKLNENNKVYIAINVIDNHFKYY
GFFNQLVRDLFEILININTIGEKTAFLILENYSYQELIDIFKNGKTDKILQLKGIGNYTA
RLIINSVQKELFNNKISEKKNKVITSLEKLGYKTKDIYKIIINVDEDLTIDELTKYVLEK
LSYINN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattatatcaatggctttttatataaaatagatgataaatttttatatttagaa
ttaaattatttaggttatagatatttatatttaaaaagtgatctgaaaaattttaagtta
aatgaaaataataaagtttatatagcaattaatgtaattgataatcattttaaatattat
ggtttttttaatcaactagtaagagatctttttgagattttgataaatattaatacaatt
ggagaaaaaacagcctttttaattttagaaaattatagttatcaagaattaattgatatt
tttaaaaatggtaaaactgataaaattttacaacttaaaggaataggaaattatacagca
agactaattataaatagtgttcaaaaagagttgttcaataacaaaataagtgaaaagaaa
aataaagtaattacaagcttagaaaaactaggttataaaacaaaagacatttataaaatc
atcattaatgttgatgaagatctaactatagatgaactaacaaaatatgttttagaaaaa
ctaagttatataaataattaa

DBGET integrated database retrieval system