KEGG   Mycoplasma capricolum: MCAP_0455Help
Entry
MCAP_0455         CDS       T00309                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mcp  Mycoplasma capricolum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCAP_0455
Enzymes [BR:mcp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCAP_0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(541179..543374)
Genome map
AA seq 731 aa AA seqDB search
MEEQIKIRGYLSKFLYKSNSWALAIFIDEKNSKKTIKIKGEITDLKPKVLYELTGKQTLH
IKYGTSFEVSSYALANINTSDQIINFLKSDVFPGIGNLTAKKIAKLYSNNFIEEILNNKE
KFLQIKDISKDKLELIYNKIKQINDQNWLRIEFINNNLSLKIFDKLKKYTDNEIEIRQLF
TNNWFEFAINNNLGLIQEIDKIFLYFNNNQIDDLTRIAYWSLTACNEILFNSGDSYTLKH
RLINKLTSLIKLNDLNIINNGLEYAFSHNLLVSDDQKIYTYESYSDELIISNAIVKHNIK
NNDINDDLLDLYIEQIQNKTSSQIKNFKYDTSQKLALKNFVKNKISIITGGPGTGKTTII
KAIVSLFEKVYHSTNYAICTPTGRAAAKIRENFYDSNATTMHKLLGYEKDKKFLINQDHP
LDYDLLIVDECSMIDARLFSQFFLSINKAKKIVLIGDVDQLASVSYGNVFFDIISSNVLS
TTNLTQIHRQNLDNGIIDLAYMIKNDNFDLNKLNSLKNVECYFNKDKDWCLEKVKEIYEK
NINNQANIQVISPVYADILGIENLNNFIQYNFNLNILDTNNIYDRLRFRYAINDKVMYLK
NDSELNLSNGDIGYISQINKTNNKFSSAIINFNNNFLEFSSEQFDDISLSYCCSVHKTQG
SEYDKVILVLQNTLFNTFINKKLLYTAITRAKKQLFIIGDYDLFLLGINKQAKLRKTTLV
KHILNNLKMKE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacaaataaaaattagaggttatttgtctaagtttttatataaatcaaattcg
tgagctttagcaatttttatagatgaaaaaaatagtaaaaaaactataaaaattaaaggt
gaaattactgatttaaaacctaaagttttatatgaacttacaggtaagcaaacgcttcat
attaaatatggaactagttttgaagttagtagttatgctttagcaaatataaatacttca
gatcaaattattaattttttaaaatctgatgtttttcctggtattggtaatttaacagct
aaaaaaatagcaaaactttattcaaacaattttattgaagaaattttaaataataaagaa
aagtttttacaaataaaagatattagtaaagataaattagaattaatttataacaaaatc
aaacaaattaatgatcaaaactggctaagaatagaatttataaataacaatttaagttta
aaaatttttgataaattaaaaaaatatactgataatgaaatagaaataagacaactattt
acaaataattgatttgaatttgctattaataacaatttaggtttaattcaagaaatagat
aaaatttttttatattttaataataatcaaattgatgacttaactagaattgcttattga
agtttaactgcttgtaatgaaattttatttaattcaggagatagttatactttaaaacat
cgtttaataaataaacttactagtttaattaaactaaatgatttaaatattattaataat
ggattagaatatgcttttagtcataatttattagttagtgatgatcaaaaaatctatact
tatgaatcttatagtgatgaattaattataagtaatgcaattgttaaacataatattaaa
aataatgatattaatgatgatttattagatttatatattgaacaaattcaaaataaaact
agtagtcaaattaaaaactttaaatatgatacttctcaaaaactagctttaaaaaatttt
gttaaaaataaaatcagtattattactggaggacctggaactggtaaaactacaattatt
aaagcaattgtaagtttgtttgaaaaagtttatcattcaactaattatgcgatttgtaca
ccaacaggaagagcagcagctaaaattagagaaaacttttatgattctaatgcaacaacg
atgcataaattattaggctatgaaaaagataaaaaatttttaataaatcaagatcatcca
ttagattatgatttattaattgttgatgagtgttcaatgattgatgcaagattatttagt
caattctttttatcaattaataaagctaaaaaaatagttttgattggtgatgttgatcaa
ttagctagtgttagttatggaaatgtattttttgatattattagtagtaatgttttaagc
acaactaatttaactcaaattcaccgtcaaaatttagataatggaattattgatttagct
tatatgattaaaaatgataattttgatttaaataagctaaatagtttaaaaaatgttgag
tgttattttaataaagataaagactggtgtttagaaaaagtcaaagaaatttatgaaaaa
aatattaacaatcaagcaaatatacaagtaatttctccagtatatgctgatattttggga
atagaaaatttaaataatttcattcaatataactttaatttaaacattttagatactaat
aatatttatgatagattaaggtttagatatgctattaatgataaagtaatgtatttaaaa
aatgatagtgaattaaatttatctaatggagatattggctatattagtcaaattaataaa
acaaataataaattttcttcagcaataattaattttaataataattttttagagtttagt
agtgagcaatttgatgatattagtttaagttattgttgtagtgttcataaaactcaaggt
agtgaatatgataaagtgattttagttttacaaaacacactctttaatacatttattaat
aaaaagttattatatacagcaataacaagagctaaaaaacaattatttattattggagat
tatgatttgtttttattaggaattaataaacaagcaaaattaagaaaaactactttagta
aaacatatcttaaataatttaaaaatgaaagaataa

DBGET integrated database retrieval system