KEGG   Mycoplasma capricolum subsp. capricolum ATCC 27343: MCAP_0750Help
Entry
MCAP_0750         CDS       T00309                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mcp  Mycoplasma capricolum subsp. capricolum ATCC 27343
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCAP_0750 (tpiA)
   01230 Biosynthesis of amino acids
    MCAP_0750 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCAP_0750 (tpiA)
   00051 Fructose and mannose metabolism
    MCAP_0750 (tpiA)
   00562 Inositol phosphate metabolism
    MCAP_0750 (tpiA)
Enzymes [BR:mcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MCAP_0750 (tpiA)
Exosome [BR:mcp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MCAP_0750 (tpiA)
  Exosomal proteins of bladder cancer cells
   MCAP_0750 (tpiA)
  Exosomal proteins of melanoma cells
   MCAP_0750 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
864962..865708
Genome map
AA seq 248 aa AA seqDB search
MRKKVIFGNWKMNGTNKSLEDFLYQVDNKVNNSKITAGLAVPYVMLQTGIKLAKNVKIAA
QNVHFELKGAYTGEISVSMLKEIGVEYVIIGHSERREMFFETDLDINKKAKILLENNMIP
IICCGESLETKEQGKTIEFVNNQINLIYQNISKQDAIKTIIAYEPIWAIGTGKTANSLDA
EEVCKKIRENLAKIYDNLTAEKITIQYGGSVKPSNIQEYLKMPNIDGALVGGASLLANDY
LGLVNYNE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtaatttttggtaattgaaaaatgaatggaactaataaaagtttagaa
gattttttataccaagttgataataaagtaaataattcaaaaattactgcaggattagcc
gttccttatgttatgttacaaactggtattaagcttgcaaaaaatgtaaaaattgcagct
caaaatgtccattttgaacttaaaggagcttatactggagaaatttcagtttcaatgtta
aaagaaattggagttgaatatgtaatcattggtcattctgaaagaagagaaatgtttttt
gaaactgatttagatattaataaaaaagcaaaaattttattagaaaacaatatgatacca
atcatttgttgtggtgaaagtctagaaactaaagagcaaggaaaaacaattgaatttgtt
aataatcaaattaatttaatatatcaaaatatttcaaaacaagatgctattaaaacaatt
atcgcttatgaaccaatttgagcaattggaactggaaaaactgcaaatagtttagatgct
gaagaagtttgcaaaaaaattagagaaaatttagcaaaaatttatgacaatctcactgct
gaaaaaataactattcaatatggtggaagtgtaaaaccttcaaatattcaagaatattta
aaaatgccaaatattgatggagctttagttggtggagcttctttattagctaatgattat
ttaggtctagttaattataatgaataa

DBGET integrated database retrieval system