KEGG   Mycobacterium canettii CIPT 140060008: BN44_10151Help
Entry
BN44_10151        CDS       T02419                                 

Gene name
PE_PGRS
Definition
(GenBank) Conserved protein of unknown function, PE-PGRS family protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
154871..156514
Genome map
AA seq 547 aa AA seqDB search
MSFVSVAPEIVVAAATDLAGIGSAISAANAAAAAPTTAVLAAGADEVSAAIAALFSGHAQ
AYQALSAQAAAFHQQFVQTLAGGAGAYAAAEAQVEQQLLAAINAPTQALLGRPLIGNGAD
GAPGTGQAGGAGGILYGNGGNGGSGAAGQAGGAGGPAGLIGHGGSGGAGGSGAAGGAGGH
GGWLWGNGGAGGSGGAGVGAGVAGGHGGAGGAAGLWGAGGGGGNGGNGADANIVSGGDGG
LGGAGGGGGWLYGDGGAGGHGGQGAIGLGGGAGGDGGQGGAGRGLWGTGGAGGHGGQGGG
TGGPPPPGQAGMGAAGGAGGLIGNGGAGGDGGVGASGGVAGVGGAGGNAMLIGHGGAGGA
GGDSSFANGAAGGAGGAGGHLFGNGGSGGHGGAVTAGNTGIGGAGGVGGDARLIGHGGAG
GAGGDRAGALVGRDGGPGGNGGAGGQLYGNGGDGGPGGQGGQAFGANNIGGAGGAGGNGG
PAILSGNGGNGGAGGAGGAGGAGGGAGGVGGAGGAPGTGGTLQAAVSGLVTALFGAPGQP
GDTGQPG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgtcagcgtagccccggagattgtggtggccgcggcaacagacctggcgggt
atcggatcggcgatcagcgcggccaatgccgccgcggctgcgccgaccaccgccgtgctg
gccgcgggtgccgatgaggtgtcggcggcgatcgcggcgctgttttccggccacgctcag
gcctatcaggcgctcagcgcccaggcggcggcgtttcatcagcagttcgtgcagacgctt
gccggtggcgctggagcatatgcggccgccgaggcccaggtcgagcagcagctgctggcc
gcgatcaacgcgcccacccaggcgctgctggggcgccccttgatcggcaacggtgccgat
ggggcgccggggactgggcaggccggcggggctggggggatcttgtacggcaatggcggc
aatggcggctccggggcggctgggcaggccgggggtgccggcgggccggccgggctgatc
ggccatggcgggtccggcggggccggcggctccggcgcggccggcggggccggcgggcac
ggcggatggctgtggggcaacggcggcgccggcggatccggcggggcgggtgtcggcgca
ggcgtggctggcggtcacggcggtgcgggcggtgccgccgggctgtggggcgccggcggc
ggcggtggcaatggcgggaacggcgccgatgccaacatcgtcagcggtggagacggtggc
ctcggcggtgccggtggcggtggcggatggctctacggcgacggcggggccggcggacac
ggcggacaaggcgcaatcggcctcggcggcggcgccggcggcgacgggggccagggcggc
gccggccgcggactgtggggtaccggcggcgccggcggacacggcgggcaaggcggtggt
accgggggcccaccgccgcccggtcaggcaggcatgggcgccgcgggtggcgccggtggg
ctgatcggcaacggcggggccggcggcgacggcggtgtcggcgcgtccggcggggtcgcc
ggagtgggcggtgccggcgggaacgccatgctgatcgggcacggcggcgccggcggcgcc
ggcggagacagcagtttcgctaatggcgcggccggcggcgcgggcggtgccggagggcac
ctcttcggcaatggcgggtccggcggccacggcggagccgtcacggccggcaacaccggt
atcggtggcgccggcggcgtcggtggggacgccaggctgatcggccacggtggcgccggc
ggtgccggcggggaccgcgccggagccttggttggccgtgacggcgggcccggtgggaac
gggggcgctggcggccagctatacggcaacggcggcgacggcgggcccggcggtcagggc
ggtcaggcgttcggcgctaacaatatcggcggcgccggcggggccggcggcaacggcggg
ccggccatcctgagtggcaatggtggcaatggcggcgccggcggcgctggcggcgccggc
ggcgcaggtggtggggccggtggggtcggcggtgccggcggcgcccccggcaccggcgga
acactgcaggcggcggtgagcggattggtgacggctttgttcggtgcacccggccaaccc
ggcgacaccggccaacccggctag

DBGET integrated database retrieval system