KEGG   Mycobacterium canettii CIPT 140060008: BN44_10154Help
Entry
BN44_10154        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
  KO
K16146  
maltokinase [EC:2.7.1.175]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN44_10154
Enzymes [BR:mcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.175  maltokinase
     BN44_10154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
159803..161170
Genome map
AA seq 455 aa AA seqDB search
MTRSDTLATKLPWSDWLPRQRWYAGRNRELATVKPGVVVALRHNLDLVLVDVTYTDGATE
RYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGPQFLLSLIVSSAVCGTSTGEV
TFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVSRGTNPDIELNRVLTRAG
NPHVARLLGAYQFGRPNRSPTDALAYALGMVTEYEANAAEGWAMATASVRDLFAEGDLYA
HEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRMLARLSSTVAVVPELREYAP
TIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDFEGEPGQPLDERRAPDSPLRD
VAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAAFCDGYAVASGIDPRDSALLLG
AYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgactcggtcggacacgctggcaaccaagctgccatggtccgattggcttccgcggcaa
cgttggtatgccggacgcaaccgcgagctggccacggtcaagccgggcgtagtcgtcgcc
ctgcgacacaacctcgacctagtcctggtcgacgtaacctacaccgacggtgcaacggag
cgttaccaggtgctcgtcggatgggattttgagccggcgtccgagtacggcacgaaagcc
gccatcggcgtcgccgacgatcgcacgggattcgacgctctctacgacgtcgccgggccg
caattcctcctgtcgctaatcgtctcgtccgccgtctgtggcacatccaccggcgaagta
acgttcaccagggagccagacgtcgagctgccctttgccgcgcagccgcgggtatgtgac
gccgaacagagcaacaccagtgtgatcttcgatcggcgggcgatcctcaaggtgttccgc
cgggtaagcagagggactaaccccgacatagagctgaaccgcgtgcttacccgtgccggt
aatccacatgtggcccgcctgctgggcgcttaccagtttgggcggcccaatcgttcgcca
accgatgctctggcgtacgccctgggcatggtgaccgagtatgaggcgaacgcggccgaa
ggctgggcgatggccaccgccagcgtgcgggacctcttcgccgagggagacctctatgcc
cacgaagtcggcggcgatttcgccggtgaatcctaccggctcggcgaggcggtcgcctcg
gtgcacgccacgctggctgacagcctcggaaccgcgcaggcaacgttcccggtggaccgg
atgctggcgcggctgtcgtcgacggtggcggtggtgcccgaactgcgggagtacgcgcca
acgatcgaacagcaattccagaagctcgcggcggaggcaatcacggtccagcgggtgcac
ggtgacctgcacttgggacaggtgctgcgtaccccggaaagctggctgttgatcgacttt
gaaggcgagccgggccagccgctggacgaacggcgagcgccggattcgccgctgcgcgac
gtggccggtgtgttgcgatcgttcgagtacgccgcttacgggccgctggtggaccaggcc
accgacaaacaacttgccgctcgcgcccgcgaatgggtcgagcgcaatcgcgccgccttc
tgcgacggctacgcggtcgcgtcgggaatcgacccgcgagattcggcgctgctgctgggc
gcctacgaactcgacaaggcggtttatgagaccggctatgagacacggcaccggccgggt
tggcttccgattccgctgcgttcgatcgcccgcctgaccgctagctga

DBGET integrated database retrieval system