KEGG   Mycobacterium canettii CIPT 140060008: BN44_10155Help
Entry
BN44_10155        CDS       T02419                                 

Definition
(GenBank) Conserved membrane protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
161238..162017
Genome map
AA seq 259 aa AA seqDB search
MQREIYDGEARLSWVLAALAGILGATAFTHSAGYFVTFMTGNSQRAVLGLFGDDAWMSVT
ASLLILFFVAGVVIASVCRRHFWAAHPHGPTVLTTFSLIFAAGVDIMLGGWHESMLDFVP
ILFVVFGIGALNTSFVKDGEVSVPLSYVTGTLVKMGQGIERHLAGGKVEDWLGYFLLHAS
FVLGAAAGGAISMVVTGPQMLAVAAVVCAATTGYTYLHADRRGLVNQKRPQPGKRLFRAL
RRGELDSGTSTPATNYGSS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacgagagatttatgacggtgaggcgcggctgtcatgggtgttggcggcgctggcc
gggatactgggggcaaccgcgttcacccactccgcgggatacttcgttactttcatgacc
ggcaattcgcagcgcgcggtgctgggattgtttggggacgacgcctggatgtctgtcacc
gcgtcgttgctgattctattcttcgtcgccggcgtggtgattgcgtcggtgtgccggcgg
catttctgggcggcgcatccccacggcccgaccgtgctgaccaccttcagtttgatattt
gccgccggagtcgacattatgctgggcggctggcacgagagcatgctcgattttgtgccg
attctgttcgtggtcttcgggattggcgccttgaacacatcgttcgtcaaggatggcgag
gtatcggttccgttgagctatgtgaccggcacattggtcaagatgggccagggcatcgaa
cgtcacctggccggcggaaaagtggaggactggctcggctacttcctgctgcacgccagc
ttcgtgctaggcgccgcggccggtggcgccattagtatggtcgtcaccggaccccagatg
ctcgcggtcgcggcggtagtgtgcgctgcgacaaccggctatacctacctgcacgctgac
cggcgagggttggtcaatcaaaagcggccccagccgggaaagcggctctttcgagcgctc
aggcgaggcgaattagattcgggaacctccacgcccgcaaccaattacgggtcgagttag

DBGET integrated database retrieval system