KEGG   Mycobacterium canettii CIPT 140060008: BN44_10159Help
Entry
BN44_10159        CDS       T02419                                 

Gene name
fgd
Definition
(GenBank) Putative f420-dependent glucose-6-phosphate dehydrogenase Fgd2
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(165271..166353)
Genome map
AA seq 360 aa AA seqDB search
MTGISRRTFGLAAGFGAIGAGGLGGGCSTRSGPTPTPEPASRGVGVVLSHEQFRTDRLVA
HAQAAEQAGFRYVWASDHLQPWQDNEGHSMFPWLTLALVGNSTSSILFGTGVTCPIYRYH
PATVAQAFASLAILNPGRVFLGLGTGERLNEQAATDTFGNYRERHDRLIEAIVLIRQLWS
GERISFTGHYFRTDELKLYDTPAMPPPIFVAASGPQSATLAGRYGDGWIAQARDINDAKL
LAAFAAGAQAAGRDPATLGKRAELFAVVGDDKAAARAADLWRFTAGAVDQPNPVEIQRAA
ESNPIEKVLANWAVGTDPGVHIGAVQAVLDAGAVPFLHFPQDDPITAIDFYRTNVLPELR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatctcacggcggacgttcggtctggccgccgggttcggcgcgatcggcgcc
ggtgggctaggcggcggttgcagcacgcgcagcggtccgacgccgaccccagagccggca
agccgcggggtgggtgtcgtcttatcccacgaacaattccgcaccgatcggctggtggcg
cacgcccaagccgccgagcaagctggcttccggtatgtgtgggccagcgaccacctacag
ccatggcaagacaacgagggccattcgatgtttccctggctgaccctggcgttggtgggc
aacagcaccagcagcatcttgttcggcaccggggtgacctgtcccatataccgctaccat
ccggccaccgtcgctcaggcgtttgcctcgctggcgatcctgaaccccggacgggtgttt
ctggggctgggcaccggcgagcggctcaacgaacaagccgccaccgacacgttcggcaac
taccgcgagcgccacgaccggctgatcgaggccatcgtactgatccgccagctgtggagc
ggtgagcggatctcgttcacgggccactattttcggaccgacgaactcaagctctacgac
acgccggcgatgccgccgccgatctttgtcgccgcgagcggcccccagagcgccaccctg
gccggccgatacggtgatggttggatcgcccaagcccgcgacatcaacgacgccaagctg
ctcgccgcgttcgccgcgggcgctcaagcggccggacgagatcccgccaccctgggtaag
cgggccgaactgttcgccgtcgtcggcgacgacaaagcggccgcccgcgccgccgacttg
tggcgattcaccgccggggccgtcgaccagcccaatccggtcgagatccagcgtgccgcc
gagtcgaacccgatcgagaaagtgctggccaattgggcggtcggtaccgatcccggcgtc
cacatcggtgcggtgcaagcggttctcgacgccggcgccgtccccttcctgcatttcccc
caggacgacccgatcaccgccatcgacttctaccgcaccaacgtcctgcccgaactgcgc
tga

DBGET integrated database retrieval system