KEGG   Mycobacterium canettii CIPT 140060008: BN44_10162Help
Entry
BN44_10162        CDS       T02419                                 

Gene name
ephF
Definition
(GenBank) Putative epoxide hydrolase EphF (epoxide hydratase) (arene-oxide hydratase)
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
167342..168244
Genome map
AA seq 300 aa AA seqDB search
MIALPALEGVEHRHVDVAEGVRIHVADAGPADGPAVMLVHGFPQNWWEWRALIGPLAADG
NRVLCPDLRGAGWSSAPRSRYTKTEMADDLAAVLDGLGVAKVKLVAHDWGGPVAFIMMLR
HPEKVTGFFGVNTVAPWVKRDLGMLRNMWRFWYQIPMSLPVIGPRVISDPKGRYFRLLTG
WVGGGFRVPDDDVRLYLDCMREPGHAEAGSRWYRTFQTREMLRWLRGEYNDARVDVPVRW
LHGTGDPVITPDLLDGYAERASDFEVELVDGVGHWIVEQRPELVLDRVRAFLAAGTEQRD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctctgcccgccttggaaggtgtcgaacatcggcacgtggatgtggcggaaggc
gtcaggatccacgttgcggacgccgggccggccgatggtccggcggtaatgctggtgcac
ggcttcccgcagaactggtgggagtggcgcgccctcatcggcccgctggccgccgacggc
aaccgggtgctgtgtcccgacctgcgcggcgcgggctggagttcggcgccccgctcgcgg
tataccaagaccgagatggctgacgatctggctgcggttttggacggcctgggtgtggcc
aaggtcaagctggtggcccacgattggggtgggccggtcgcgttcatcatgatgttgcgc
catcccgagaaggtgaccgggtttttcggcgtgaacaccgtggcaccctgggtgaagcgc
gatcttggcatgctccgcaatatgtggcggttctggtatcagatccccatgtcgctgccg
gtgatcggcccgcgggtgatcagcgatcctaagggccgctacttccggctgttgaccggg
tgggtcgggggcggatttcgggttcccgatgacgacgtgcgcctgtacttggactgcatg
cgcgagccggggcacgccgaggccggatcgcggtggtatcgcacctttcagaccagggaa
atgctgcgctggctgcgcggcgagtacaacgacgctcgggtcgatgtcccggtccgatgg
ctgcacggcaccggagatccggtgatcacgcccgacctgctggacggctatgccgagcgg
gccagcgatttcgaggtggagctggtcgacggcgtgggccattggatcgtcgagcagcga
cccgagctggtgctcgaccgggtgcgcgcgttcctagctgcggggaccgagcagcgcgat
tga

DBGET integrated database retrieval system