KEGG   Mycobacterium canettii CIPT 140060008: BN44_10174Help
Entry
BN44_10174        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function. Possible S-adenosylmethionine-dependent methyltransferase
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LCM Methyltransf_19
Motif
Other DBs
NCBI-ProteinID: CCK50062
Position
176791..177744
Genome map
AA seq 317 aa AA seqDB search
MTELDDVSSLPSSRRTAGDTWAITESVGATALGVAAARAVETAATNPLIRDEFAKVLVSS
AGTAWARLADADLAWLDGDQLGRRVHRVACDYQAVRTHFFDEYFGAAVDAGVRQVVILAA
GLDARAYRLNWPAGTVVYEIDQPSVLEYKGGILQSHGAVPTARRHAVAVDLRDDWPAALI
AAGFDGTQPTAWLAEGLLPYLPGDAADRLFDMVTALSAPGSQVAVEAFTMNTKGNTQRWN
RMRERLGLDIDVQALTYHEPDRSDAAQWLATHGWQVHSVSNREEMARLGRAIPQDLVDET
VRTTLLRGRLVTPAQPA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaactcgacgacgtgtcctcgttaccatcctcgcgacggaccgctggcgatacc
tgggcgatcaccgaaagcgttggcgccaccgcgttgggggtcgcggcggcacgtgccgtg
gaaacggccgcgaccaatccgctgatccgtgacgagttcgccaaggtgttggtgtcgtcg
gcgggtaccgcctgggcacggctggccgacgccgatttggcctggctcgacggtgatcag
ctcggccgacgcgtgcatcgggttgcctgcgactaccaggcggtgcgcacccacttcttc
gacgagtacttcggtgccgccgtcgacgcaggtgtccggcaggtggtgatcctcgctgcc
ggactggacgctcgggcctaccgcctgaactggccggcgggcactgtggtttacgagatc
gaccagccttcggtgttggagtacaagggggggattcttcaatcgcatggcgcggttcca
acggcgagacggcatgccgtcgcggtggacctgcgcgacgactggccggccgcgctgata
gctgccggattcgatggcactcaaccgactgcctggctagccgagggcttgctgccctac
ctgcccggcgacgccgcggaccggctattcgacatggtcaccgcgctcagcgcaccgggc
agccaggtcgctgtcgaggctttcaccatgaacacaaagggcaacacgcagcgctggaat
cggatgcgcgagcgactcggtttggacatcgatgtccaggcgttgacctaccacgagccc
gaccggtcggatgccgcgcaatggctggctacgcatggctggcaggtgcacagcgtgagc
aatcgcgaggagatggcccgactgggccgggcgatcccgcaagacctggtcgacgagacc
gtccgcaccacgttgctgcgagggcgtctggtcacacccgctcaaccggcgtga

DBGET integrated database retrieval system