KEGG   Mycobacterium canettii CIPT 140060008: BN44_10181Help
Entry
BN44_10181        CDS       T02419                                 

Gene name
PE
Definition
(GenBank) Conserved protein of unknown function, PE family
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PE-PPE PE Chloroplast_duf T7SS_ESX_EspC
Motif
Other DBs
NCBI-ProteinID: CCK50069
Position
complement(184952..186604)
Genome map
AA seq 550 aa AA seqDB search
MSYLIAEPRIVAAAAAEVAGIGSAVSTASAAAAGPTSALAAAAGDEVSAAIAKLFGAYGQ
EYQAVLAQVEAFHSRFHQTLAAAAHTYADAEAAIASTLQNQLAVPAAAPTPAAAAMVPPF
PANLTTLFFGPTGIPLPPPSYVDAANMLYVRSAGALQAVFTPEELYPLTGVRSLVLNTSV
EEGLTIMHDAIMGELAIPGNTVTVFGWSQSAIIASLEMHRLAAMGPAAPPASDLNFVLVG
NEMNPNGGMLARFPDLTLPSLGLTFYGATPSDTIYPTAIYTLEYDGFADFPRYPLNIISD
LNAVAGITFVHTKYLDLTPAQVDGATKLPTSPGYTGVTDYYIIRTENLPLLQPLRAVPVI
GDPLADLIQPNLKVIVNLGYGDPNYGYSTSYADVRTPFGLWPDVPPQVIADALAAGTQQG
ILDFTADLQALSAQPLTLPQIQLPQPADLVAAVAAAPRPEEVVNTLARIISTNYAVLLPT
ADIALALVTTLPLYTTQLFVSQLAAGNLINAIGYPLAATVGLGTIAGGVELLTLLAAASD
TVRNIEGLVT
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatctgatcgctgagccgcggatcgtagcggcggccgccgccgaggtggcagga
atcggttcggccgtgagtacggccagcgcggccgcggcaggcccgacgtccgcactggcc
gcggcggccggcgatgaggtgtcggccgccatcgcgaaactgttcggcgcatacggccag
gaataccaggccgtgctcgctcaagtcgaggcgtttcacagtaggttccaccagacgttg
gccgccgcggcgcacacctacgcagatgccgaggccgccatcgccagcaccctgcaaaat
cagctggctgtgcccgccgccgcgccaacccccgcggcggccgcgatggttccgccattc
ccggcgaacttgaccaccttgttctttgggcccaccggaattccactaccaccgccgtcc
tatgttgacgccgccaacatgctgtacgtccgttcggcgggcgccttacaagccgtcttc
acacccgaagagttgtacccactcaccggtgtcagaagtttggtgctcaacacgtcggtg
gaagagggcttgaccatcatgcacgacgcgatcatgggagagctggcgatccccggaaac
acggtcaccgttttcggctggtcgcaaagcgccattatcgcgtcgctggagatgcacagg
ctcgcggcgatgggtccggccgcacctccggcgagcgacctcaattttgtgcttgtcggc
aatgaaatgaaccccaatggcggtatgctcgcgcggttcccggatctgacgctgccgagt
ctgggcctgacgttctacggcgcaacgccctcggacacgatctatccgacggccatctac
acgctcgagtacgacgggttcgccgacttcccgcgatacccgctcaatatcatttccgac
ctcaacgcggttgcaggcatcacattcgtacacaccaagtatttggacctcacgcccgcg
caggtcgacggcgctaccaaattgccgacctcgccgggctatacaggggtcaccgactac
tacatcatccgcaccgagaatctgccgctgctgcaaccgctgcgggcggtgcccgtcatc
ggggatccgctggccgacctgatccagccgaacctgaaggtgatcgtcaacctgggctac
ggcgacccgaactacggctactcgacgagctacgccgacgtgcgaacgccgttcgggctg
tggcccgacgtgccgcctcaggtcatcgccgatgccctggccgccggaacacaacaaggc
atccttgacttcacggccgacctgcaggcactgtccgcgcaaccgctcacgctcccgcag
atccagctgccgcaacccgccgatctggtggccgcggtggccgccgcaccgaggccggag
gaggtggtgaacacgctcgccaggatcatctcaaccaactacgccgtcctgctgcccacc
gcggacatcgccctcgccctggtcaccaccctgccgctctacaccacccaactgttcgtc
agccaactcgctgcgggcaatctgatcaacgcgatcggctatcccctggcggccaccgta
ggtttaggcacgatagcgggcggcgtggaattgctcaccctcctcgcggcggcctcggac
accgttcgaaacatcgagggcctcgtcacctga

DBGET integrated database retrieval system