KEGG   Mycobacterium canettii CIPT 140060008: BN44_10183Help
Entry
BN44_10183        CDS       T02419                                 

Gene name
fadE
Definition
(GenBank) Acyl-CoA dehydrogenase FadE2
  KO
K00249  
acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN44_10183 (fadE)
  Lipid metabolism
   00071 Fatty acid degradation
    BN44_10183 (fadE)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN44_10183 (fadE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN44_10183 (fadE)
Enzymes [BR:mcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     BN44_10183 (fadE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(187553..188764)
Genome map
AA seq 403 aa AA seqDB search
MSAMAIDYRTRLSDFMTEYVFPAEADYDDYRRTAGPADHTVPPIIEELKTKAKDRGLWNL
FLPAESGLTNLEYAPLAEMTGWSMEIAPEALNCAAPDTGNMEILHMFGTEQQRAQWLRPL
LDGKIRSAFSMTEPAVASSDARNIETTISRDGADYVINGRKWWTSGAADPRCKILIVMGR
TNPDAATHQQQSMVLVPIDTPGVTIVRSTPVFGWQDRHGHCEIDYHNVRIPATNLLGEEG
SGFAIAQARLGPGRIHHCMRALGAAERALALMVNRVRNRVAFGRPLAEQGVVQQAIAQSR
NEIDQARLLCEKAAWTIDQHGNKEARHLVAMIKAVAPRVACDVIDRAIQVHGAAGVSDDT
PLARLYGWHRAMRIFDGPDEVHLRSIARAELSREKSTFAAAVT
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccatggccatcgactaccgcacgcggttgtccgacttcatgaccgagtacgtg
tttccggctgaggccgattacgacgactatcgccgcacggccggaccggccgaccatacc
gtgccgccgatcatcgaggaactgaaaaccaaggccaaagaccgcggcctgtggaaccta
ttcctgccggccgagtcgggattgaccaacctggagtacgcgccgctggccgaaatgacc
ggatggagcatggaaatcgcgcccgaggcactcaactgcgccgcgccggacaccggcaac
atggagatcctgcacatgttcggcaccgagcagcaacgggcgcaatggctgcggccgctg
ctcgacggcaagatccgcagcgccttctcgatgaccgagccggcggtggccagcagcgac
gcccgcaacatcgaaaccaccatctcccgggacggtgccgactacgtcatcaacggccgt
aaatggtggacgtcgggagcggcggacccgcgctgcaagatcctcatcgtgatgggccgc
accaacccggacgcggccacccaccaacagcagtcgatggtcctcgtcccgatcgacacc
cccggggtgacgatcgttcgctccacaccggtgttcggctggcaggaccggcacggccac
tgcgagatcgactaccacaacgtccggatcccggccaccaacctgctcggcgaagagggc
agcggcttcgccatagcccaggcccggctgggaccgggccgtatccaccactgcatgcgt
gcgctgggcgcggccgaacgcgcgttggcgctcatggtgaatcgggtccgcaaccgggtg
gcgttcggccgtccgctggccgaacagggcgtcgtgcaacaggcgattgctcagtcccgc
aacgaaatcgaccaggccaggctgctgtgcgaaaaggcggcgtggacaatcgaccaacac
ggcaacaaagaggcgcgccacctggtcgccatgatcaaggcggtggccccgcgggtggcc
tgcgatgttatcgaccgcgcaatccaggtccacggggccgccggtgtcagcgacgacacc
ccgctggcccggctgtacggctggcaccgcgccatgcgcatctttgacggtcccgacgag
gtgcacctgcgctccatcgcccgcgccgagctgtcgcgggagaagtccacctttgccgcg
gcggtcacctga

DBGET integrated database retrieval system