KEGG   Mycobacterium canettii CIPT 140060008: BN44_10192Help
Entry
BN44_10192        CDS       T02419                                 

Gene name
PE
Definition
(GenBank) Conserved protein of unknown function, PE family
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PE-PPE PE T7SS_ESX_EspC Cutinase
Motif
Other DBs
NCBI-ProteinID: CCK50078
Position
complement(194497..196005)
Genome map
AA seq 502 aa AA seqDB search
MSYLVTAPDMLATAAAHVDEIASTLRAANAAAAGPTCNLLAAAGDEVSAATAALFSAYGR
EYQAVVKQAAAFHSEFTRTLAAAGNAYAHAEAANAAWVSHALDTINAPIRTLLGLAPLSP
NGSSGAGGLPSIAQLAAESPITALIMGGTNNPLPDPEYVTDINKAFIQTLFPGAVSQGLF
TPEQFWPVTPDLGNLTFNQSVTEGVALLNTAVNNQLALGNKVVAFGYSQSATIINNYINS
LMAMGSPNPDDISFVMIGSGNNPVGGLLARFPGFYIPFLDVPFNGATPANSPYPTHIYTA
QYDGIAHAPQFPLRILSDINAFMGYFYVHNTYPELMATQVDNAVPLPTSPGYTGNTQYYM
FLTQDLPLLQPIRDIPYAGPPIADLFQPQLRVLVDLGYADYGPGGNYADIPTPAGLFSIP
NPFAVTYYLIKGSLQAPYGAVVEIGVEAGLIGPEWFPDSYPWVPSINPGLNFYFGQPQVT
LLSLMSGGLGNILHLIPPPVFT
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacctggtcacagcccctgacatgctggcgacggcagctgcccatgtggatgag
atcgcttccacgctgcgggccgccaacgcggctgcggcaggcccgacatgtaacctgctg
gccgcggccggcgatgaggtttcggcggcaacggcggccctgttcagcgcatacgggcgg
gagtatcaggcggtcgtcaagcaggccgcggcgttccacagcgagttcacccggacgttg
gcggccgccggcaacgcctacgcacacgccgaagcggccaatgcggcctgggtatcgcac
gcgctggacactatcaacgcaccgatccggacgctgttgggccttgcgccgttgagcccc
aacggatccagcggggccggcgggctgccgtcgatcgcgcagctggctgcggagagtccg
ataacggcgttgattatgggcggcaccaataacccgctacccgaccccgaatacgtgacg
gacatcaacaaggctttcatccagaccctcttcccgggcgctgtctcgcaaggcctgttc
acacccgagcagttctggccggttacccccgacctcggcaatctaacgttcaaccagtcc
gtgaccgaaggcgtggcgctgctgaataccgccgtcaacaaccaactggcccttggtaac
aaggttgtcgcgttcggctactcgcagagcgccacgataatcaacaactacatcaattcg
ctgatggcgatgggttcgccgaatccggacgatatctccttcgtcatgattggtagtggc
aacaatcccgtcggcgggctcctggcgcgcttccccggcttctacatcccgttcctggac
gtgccgttcaatggcgcaaccccggcgaatagtccctacccgacacacatttacacggcc
cagtacgacggcatcgcccacgcgccgcaattcccgctgcgcatcctgtcggacatcaac
gccttcatgggctacttctacgtgcacaacacgtacccggaactcatggccacccaggtg
gataacgcggtgccgttgccgacctccccgggctataccggcaacacccagtactacatg
ttcctgactcaggatctgccactgctccagccgatccgtgacatcccctacgccggtccc
ccgatcgccgacctgttccagccgcagctgcgggtgctcgtcgacttgggctacgccgac
tacgggccgggcggcaattacgcggatatccccaccccggccgggctgttctcgatcccc
aacccgttcgctgtcacgtattacctgatcaaagggagcctgcaggcgccctatggcgcc
gtcgtggagattggggtggaagccggattgattgggccggagtggttcccggacagctat
ccgtgggtcccgtcgataaacccgggcctgaatttctacttcggccagccacaggtgaca
ctgctatccctgatgagtggcggtctcggcaacatcctgcacctgatcccgccaccggtc
ttcacctga

DBGET integrated database retrieval system