KEGG   Mycobacterium canettii CIPT 140060008: BN44_10197Help
Entry
BN44_10197        CDS       T02419                                 

Gene name
TB18
Definition
(GenBank) Conserved protein of unknown function TB18.5
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
199192..199677
Genome map
AA seq 161 aa AA seqDB search
MTAILCSPRPRYASRMPVLSKTVEVTADAASIMAIVADIERYPEWNEGVKGAWVLARYDD
GRPSQVRLDTAVQGIEGTYIHAVYYPGENQIQTVMQQGELFAKQEQLFSVVATGAASLLT
VDMDVQVTMPVPEPMVKMLLNNVLEHLAENLKQRAEQLAAS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaatcttgtgctcaccgcgacccaggtatgcttcccgaatgccagttttgagc
aagaccgtcgaggtcaccgccgacgccgcatcgatcatggccatcgttgccgatatcgag
cgctacccagagtggaatgaaggggtcaagggcgcatgggtgctcgctcgctacgatgac
gggcgtcccagccaggtgcggctcgacaccgctgttcaaggcatcgagggcacctatatc
cacgccgtgtactacccaggcgaaaaccagattcaaaccgtcatgcagcagggtgaactg
tttgccaagcaggagcagctgttcagtgtggtggcaaccggcgccgcgagcttgctcacg
gtggacatggacgtccaggtcaccatgccggtgcccgagccgatggtgaagatgctgctc
aacaacgtcctggagcatctcgccgaaaatctcaagcagcgcgccgagcagctggcggcc
agctaa

DBGET integrated database retrieval system