KEGG   Mycobacterium canettii CIPT 140060008: BN44_10198Help
Entry
BN44_10198        CDS       T02419                                 

Definition
(GenBank) Putative transcriptional regulatory protein (Probably gntR-family)
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR RtcR
Motif
Other DBs
NCBI-ProteinID: CCK50083
Position
complement(199691..200506)
Genome map
AA seq 271 aa AA seqDB search
MIKVGVVWVTLWPERPNNKPPPSPRQVPGNPGPTLKVLASHVNAPLSAKPRSQLPLRRAQ
LSDEVAGHLRAAIMSGALRSGTFIRLDETAAELGVSITPVREALLKLRGEGMVGLEPHRG
HVVLPLTRQDIDDIFWLQATIAQELATSATAHITDVEIDELDRINNALAGAIGSGDAKTI
ASIEFAFHRVFNKASRRIKLAWFLLNAARYMPAQVFAADPRWGADAVNSHRQLIAALRRR
DTAAVIEHTVWQFTDGARRLTEALAETEVFG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaggttggtgttgtctgggtcacactatggcctgagcggcccaacaacaagccc
ccgccaagcccccggcaagtccccggcaatcccggcccgaccctgaaagtcctggcaagc
cacgtgaacgcacctctatcggcgaagccgcggagccagcttcccctgcgccgggcacag
ttgtccgacgaggtcgcgggccacctgcgggccgccatcatgtcgggcgcgctgcgctct
ggaacgttcatccgtctggacgagacggcagccgagctcggagtcagcatcacgccggtg
cgggaggcgctgctgaaactgcgcggtgaggggatggtcgggctggagccacatcgcggc
cacgtggtgctgccgttgacccgccaagacatcgacgacattttctggctgcaggccacc
attgcccaagaacttgccacatcggccaccgctcacatcaccgacgttgagatcgacgag
ctggaccgcatcaacaatgcgctggccggtgctatcgggtccggtgatgccaaaaccatc
gcgtcgatcgagttcgcgttccaccgcgtcttcaacaaagcgagccgccggatcaagttg
gcctggttcctgcttaatgccgcgcgctatatgccggcgcaggtgttcgcggccgacccg
cgatggggcgcggacgcggtgaacagtcatcggcagctgatcgccgcgctgcgccgccgc
gacacagccgccgtaatcgagcacaccgtctggcagttcaccgatggggcacgcaggctg
acggaggccctggctgagaccgaagtcttcggctga

DBGET integrated database retrieval system