KEGG   Mycobacterium canettii CIPT 140060008: BN44_10199Help
Entry
BN44_10199        CDS       T02419                                 

Gene name
fadD
Definition
(GenBank) Putative fatty-acid-coa ligase FadD5 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Brite
Enzymes [BR:mcq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     BN44_10199 (fadD)
Lipid biosynthesis proteins [BR:mcq01004]
 Acyl-CoA synthetase
  Unknown
   BN44_10199 (fadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
200561..202225
Genome map
AA seq 554 aa AA seqDB search
MTAQLASHLTRAPTLAQQQPYLARRQNWVNQLERHAMMQPDAPALRFVGNTMTWADLRRR
VAALAGALSGRGVGFGDRVMILMLNRTEFVESVLAANMIGAIAVPLNFRLTPTEIAVLVE
DCAAHVMLTEAALAPVAIGVRDIQPLLSVIVVAGGSSEDSVFGYEDLLNEAGDVVEPVDI
PNDSPALIMYTSGTTGRPKGAVLTHANLTGQAMTALYTSGANINSDVGFVGVPLFHIAGI
GNMLTGLLLGLPTVIYPLGAFDPGQLLDVLEAEKVTGIFLVPAQWQAVCTEQQARPRDLR
LRVLSWGAAPAPDALLRQMSATFPETQILAAFGQTEMSPVTCMLLGEDAIAKRGSVGRVI
PTVAARVVDQNMNDVPVGEVGEIVYRAPTLMSCYWNNPEATAEAFAGGWFHSGDLVRMDS
DGYVWVVDRKKDMIISGGENIYCAELENVLASHPDIAEVAVIGRADEKWGEVPIAVAAVT
NDDLRIEDLGEFLTDRLARYKHPKALEIVDALPRNPAGKVLKTELRLRYGACVNVERRSV
SADFTDRRENRQRL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcgcaactggccagtcacctgacgcgggcgccaacactagcccaacagcagccc
taccttgctcgccggcagaactgggtcaaccagctcgaacggcacgcgatgatgcagcca
gacgcgccggcgctgaggtttgtgggcaacaccatgacgtgggctgacctgaggcgccgg
gttgcggcgctggcgggcgccttgagcggtcgcggggtcggtttcggcgatcgggtcatg
atcctgatgcttaaccgcaccgagttcgtcgagtcggtgctggccgccaacatgatcggg
gccatcgccgtaccactgaatttccggctcaccccaaccgaaatcgccgtcctggtcgaa
gactgtgccgcacacgtgatgctgaccgaagctgcgctggctccggtggccatcggtgtc
cgcgacatccagcccttgctgagcgtgatcgtggtcgccggcggatccagcgaggacagc
gtgttcggctatgaggacctactcaacgaggccggcgatgtcgtcgaaccggtggacatc
ccgaacgactcgccggccttgatcatgtacacctcgggcaccaccgggcgcccgaagggc
gccgtgctgactcacgcgaacctcaccggtcaggcgatgaccgcgctctacaccagtggc
gccaacatcaacagcgacgtcggtttcgtcggcgtcccgctgtttcatatcgccggaatc
ggcaacatgctgaccgggctgctgctcggcttgcccacggtgatctatccgctgggcgcg
ttcgacccgggacagctgctcgacgtgctggaggcagagaaggtcaccggcatctttctg
gttcccgcgcagtggcaggcggtctgtaccgaacagcaagcacgaccacgtgacctgagg
ttacgggtgttgtcgtggggagctgcgccggcgccggatgcgttgctgcggcagatgtcg
gcaacctttcccgaaacgcagatactggccgcattcggccagaccgagatgtcgccggtc
acctgcatgctgctcggcgaagatgcgatcgctaagcgcggatcggtcggcagggtgatt
ccgaccgtcgccgcaagggtggtcgatcagaacatgaacgatgtccccgtcggcgaagtg
ggcgaaattgtctaccgggcaccaacattgatgagctgctactggaacaacccggaggcc
accgcggaggcgttcgcaggcggctggttccattctggggatctggttcgcatggactcc
gacggttacgtctgggtggtggaccgcaagaaggacatgattatctccggcggtgaaaac
atttactgcgccgagctggaaaacgttctggccagccatcccgacatcgccgaagtcgcg
gtcatcggccgggccgacgagaagtggggagaggtgccgatcgcggtcgcggccgtaacg
aacgacgaccttcggatcgaagacctaggtgagttcctgaccgaccggcttgcgcgctac
aagcaccccaaggcgctcgagatcgtggacgctctgccccgcaaccccgcggggaaggtg
ctcaagactgaactgcgattgcgctatggcgcctgtgtgaatgttgaaagacgttctgta
tcagctgattttacggatagaagggaaaatcgacagagattgtaa

DBGET integrated database retrieval system