KEGG   Mycobacterium canettii CIPT 140060008: BN44_10202Help
Entry
BN44_10202        CDS       T02419                                 

Gene name
mce1A
Definition
(GenBank) Conserved protein of unknown function, MCE family Mce1A, involved in entry and survival inside cells
  KO
K02067  
phospholipid/cholesterol/gamma-HCH transport system substrate-binding protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
ABC transporters
Module
Mce transport system
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BN44_10202 (mce1A)
Transporters [BR:mcq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter [MD:M00669]
    BN44_10202 (mce1A)
   Phospholipid transporter [MD:M00210]
    BN44_10202 (mce1A)
   Mce system transporter [MD:M00670]
    BN44_10202 (mce1A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
204103..205467
Genome map
AA seq 454 aa AA seqDB search
MTTPGKLNKPRVPPYKTAGMGLVLVFALVVALVYLQFRGEFTPKTQLTMLSARAGLVMDP
GSKVTYNGVEIGRVDTISEVTRDGESAAKFILDVDPRYIHLIPANVNADIKATTVFGGKY
VSLTTPKNPTKRRITPKDVIDVRSVTTEINTLFQTLTSIAEKVDPVKLNLTLSAAAEALT
GLGDKFGESIVNANTVLDDLNARMPQSRHDIQQLAALGDVYSDAAPDLFDFLDSSVTTAR
TINAQQAELDSALLAAAGFGNTTADVFDRGGPYLQRGVADLVPTATLLDTYSPELFCTIR
NFYDADPLAKAAAGGGNGYSLRTNSEILSGIGISLLSPLALATNGAAIGIGLVAGLIAPP
LAVAANLAGALPGIVGGAPNPYTYPENLPRVNARGGPGGAPGCWQPITRDLWPAPYLVMD
TGASLAPYNHMEVGSPYAVEYVWGRQVGDNTINP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgccggggaagctgaacaagccgcgagtgccgccctacaagacggcgggtatg
ggtctagtgctggtcttcgcgctcgtagttgccttggtatacctgcagtttcgcggggag
ttcacgcccaagacgcagttgacgatgctgtccgctcgtgcgggcttggtgatggatccc
gggtcgaaggtcacctataacggggtggagatcgggcgggtggacaccatctcggaggtc
acgcgtgacggcgagtcggcggccaagttcatcttggatgtggatccgcgctacatccac
ctgattccggcaaatgtgaacgccgacatcaaggcgaccacggtgttcggcggtaagtat
gtgtcgttgactacgccgaaaaacccgacaaagaggcggataacgcccaaagacgtcatc
gacgtgcggtcggtaaccaccgagatcaacacgttgttccagacgctcacctcgatcgcc
gagaaggtggatccggtcaagctgaatctgaccctgagcgcggccgcggaggcgttgacc
gggctgggcgacaagttcggcgagtcgatcgtcaacgccaacaccgttctggatgacctc
aatgcgcggatgccgcaatcgcgccacgacattcagcaattggcggcgctgggcgacgtc
tactccgacgcggcaccggacctgttcgactttctcgatagttcggtgaccaccgcccgc
accatcaatgcccagcaagcggaactggattcggcgctgttggcggcggccgggttcggc
aacaccacagccgatgtcttcgaccgcggcgggccgtatctgcagcggggggtcgccgat
ctggtccccaccgccaccctgcttgacacttatagcccggaactgttctgcacgatccgc
aacttctacgatgccgatccgctcgctaaggcggcggccggtggcggtaacggctactcg
ctgaggacgaactcagagatcctctccgggataggtatctccttgttgtctcccctggcg
ttagccaccaatggggcggcaatcggaatcggactggtagccggattgatagcgccgccc
ctcgcggtggccgcaaatctagcgggagccctacccggaatcgttggcggcgcgcccaat
ccctatacctatccggagaatctgccgcgggtgaacgctcgcggtggcccggggggcgcc
cccggttgctggcagccgatcacccgggatctgtggccagcgccgtatctggtcatggac
accggtgccagcctcgccccgtacaaccacatggaggttggctcgccttatgcagtcgag
tacgtctggggccgtcaggtaggggataacacgatcaacccatga

DBGET integrated database retrieval system