KEGG   Mycobacterium canettii CIPT 140060008: BN44_10204Help
Entry
BN44_10204        CDS       T02419                                 

Gene name
mce1C
Definition
(GenBank) Conserved protein of unknown function, MCE family Mce1C, involved in entry and survival inside cells
  KO
K02067  phospholipid/cholesterol/gamma-HCH transport system substrate-binding protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq02010  ABC transporters
Module
mcq_M00670  Mce transport system
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BN44_10204 (mce1C)
Transporters [BR:mcq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter [MD:M00669]
    BN44_10204 (mce1C)
   Phospholipid transporter [MD:M00210]
    BN44_10204 (mce1C)
   Mce system transporter [MD:M00670]
    BN44_10204 (mce1C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaD Mce4_CUP1 DUF948 DUF1664
Motif
Other DBs
NCBI-ProteinID: CCK50089
Position
206501..208048
Genome map
AA seq 515 aa AA seqDB search
MRTLEPPNRMRIGLMGIVVALLVVAVGQSFTSVPMLFAKPSYYGQFTDSGGLHKGDRVRI
AGLGVGTVEGLKIDGDHIVIKFSIGTNTIGTESRLAIRTDTILGKKVLEIEPRGAQALPP
GGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSETVDQTYPHLSAALDGVA
KFSDTIGKRDEQITHLLAQANQVASVLGDRSEQVDRLLVNAKTLIAAFNERGRAVDALLG
NISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLAETLTILGRFSASFGETFAS
GPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAGLPAYRWPDPNGTRFPNGAPP
PPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPLPCANLTQGPFGGPDFPAPLDV
ATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQEAPPGARTLPLGPAPGPAPPPA
APGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgctggaaccacccaaccgaatgcgaattgggctcatgggcatcgtcgttgcg
ctgctcgttgtcgctgtgggccaaagctttaccagtgttcccatgttattcgcaaagccg
agctactacggccagttcaccgactccggcggactgcacaagggcgacagggtacgcatc
gccggcttgggagtgggcaccgtggaggggctcaagatcgacggcgaccacatcgtgatc
aagttctccatcggcaccaacaccatcggcaccgagagccgcctagccatccgcaccgac
accatcctgggtaagaaagtgctcgagatcgagccgcgcggcgcccaagcgttgccgccc
gggggcgttttgccggttgggcaaagcaccaccccgtaccagatttacgacgcgttcttc
gacgtcaccaaggccgcatccggctgggacatcgagacggtcaagcggtcgctgaatgtg
ttgtcggagaccgttgatcagacctatccgcacctgagcgccgccctcgacggggtggct
aagttctccgacaccatcggcaagcgcgacgagcagatcacgcacctactagcccaggcc
aaccaggtggccagcgtcctgggtgatcgcagcgagcaggtcgaccgcctgttggtcaac
gctaagaccctgatcgccgcgttcaacgagcgtggccgcgcggtcgacgccctgctgggg
aacatctccgctttctcggcccaggtgcaaaaccttatcaacgacaacccgaacctgaac
catgtgctcgagcagctgcgtatcctcaccgacctgttggtcgaccgcaaggaggatttg
gctgaaaccctgacgatcttgggcagattcagcgcgtcgttcggtgagacgtttgcctct
gggccctacttcaaagtgctgctggccaacctggtgccgggtcagatcttgcagccgttt
gtcgatgcggcattcaagaagcgtggtattagcccggaggacttctggcgcagcgccggg
ctgccggcataccggtggcccgaccccaatggcacccggttccccaacggtgcgccgccg
ccaccgccgccggtgttggagggcacgcccgagcatcccgggccggcggtgccgccggga
tcgccgtgctcctacaccccgccggcggacggtctgccgcggccgtgggatccgctgccc
tgcgccaacctcactcaaggtccattcggtggccccgatttcccggcgccgctggatgtc
gcgacgtcgccgccgaacccggacggtccaccgcccgccccgggcctaccaatcgcggga
cgtccgggtgaggtgccgccgaacgttcccggcacgccggtgccgattccgcaggaggct
cccccaggggcacgcacgctgcccctcgggccggcgcctggtccggctccgcccccggcg
gcgccaggcccgccggcaccaccgggccccgggccgcagttgccggccccgttcatcaat
cccggcggcaccggcggtagtggcgtgacgggaggtagcgagaattga

DBGET integrated database retrieval system