KEGG   Mycobacterium canettii CIPT 140060008: BN44_10224Help
Entry
BN44_10224        CDS       T02419                                 

Definition
(GenBank) Conserved membrane protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
227912..229153
Genome map
AA seq 413 aa AA seqDB search
MTAPTGTSATTTRPWTPRIATQLSVLACAAFIYVTAEILPVGALSAIARNLRVSVVLVGT
LLSWYALVAAVTTVPLVRWTAHWPRRRALVVSLVCLTVSQLVSALAPNFAVLAAGRVLCA
VTHGLLWAVIAPIATRLVPPSHAGRATTSIYIGTSLALVVGSPLTAAMSLMWGWRLAAVC
VTGAAAAVALAARLALPEMVLRADQLEHVGRRARHHRNPRLVKVSVLTMIAVTGHFVSYT
YIVVIIRDVVGVRGPNLAWLLAAYGVAGLVSVPLVARPLDRWPKGAVIVGMTGLTAAFTL
LTALAFGERHTAATALLGTGAIVLWGALATAVSPMLQSAAMRSGGDDPDGASGLYVTAFQ
IGIMAGALLGGLLYERSLAMMLTASAGLMGVALFGMTVSQHLFENPTLSPGDG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactgccccaaccggaacctccgccactacgacgcgaccgtggacgccacggatcgcc
acgcaactgtccgtgctggcttgcgcggcctttatctatgtcaccgccgaaatcctgccg
gtgggcgcgctgtcggcgatagcgcggaacttgcgcgtcagcgtggtcctagttgggacc
ttgctgtcctggtatgcccttgtcgcggccgtgacaacggttccgctggtgcgttggacc
gcacactggccgcgccgccgggccctggtggtcagcctggtctgcctgaccgtctcgcaa
ctcgtctcggcgctggcgcccaacttcgcggtgctggccgccgggcgggtgctctgcgcg
gtcacccatggcctgctgtgggcggtcatcgcgccgatcgccacccggctggtgccgccc
agtcacgccgggcgcgccacgacgtcgatctacatcggaaccagtctggcgctggtcgtc
ggtagcccactcacggctgccatgagcctgatgtggggttggcggctggcggcggtgtgc
gtgaccggcgcggcggccgcggtcgccctggccgcccggctggcgttgccggagatggtg
ctgcgcgccgaccagctcgagcacgttggccgacgggctcgtcaccaccgtaatcctcgc
ctggtcaaggtcagtgtgctcacgatgatcgcggtaaccggccatttcgtgtcctacacc
tacatcgtggtgatcatccgcgacgtcgtcggtgtacgtgggccgaatctggcctggctg
ctcgccgcctatggggtcgccggcctggtgtctgtgccgctggtggcgcggccgttggac
cgttggcccaagggcgccgtcatcgtcggtatgaccggactgacggcggcgttcaccttg
ctgaccgcgctggcattcggtgaacgccacaccgcggcgacggcactgctgggcaccggt
gcgattgtgctgtggggagccttggccaccgccgtgtcaccgatgctgcaatctgcggcg
atgcgtagcggcggcgacgacccggacggggcctcaggtttgtatgtgacggcgtttcag
atcggcatcatggccggcgctctgctgggtgggctgctctacgagcgcagcttggcgatg
atgctgaccgcgtcggcgggtttgatgggtgttgcgttgttcgggatgacggttagccag
cacttgttcgagaatccgactctgagtcccggcgacggctaa

DBGET integrated database retrieval system