KEGG   Mycobacterium canettii CIPT 140060008: BN44_10229Help
Entry
BN44_10229        CDS       T02419                                 

Definition
(GenBank) Transcriptional regulator, LuxR family
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE HTH_23 HTH_29 HTH_38 GcrA Sigma70_r4 EF-hand_11
Motif
Other DBs
NCBI-ProteinID: CCK50114
Position
236524..237159
Genome map
AA seq 211 aa AA seqDB search
MAPVNVISVAVVASDPLTRDGALARLSSHRELDVRAWQAGCETSVLLVLATTITAPLLCQ
IEDVQKDGPSHAPKLVVVADEFSAEQVFRMIKLGLTGLLYRSQSTFDCIVETIRLSAEGR
LRLPERVQRYLVGRIKSTPTAEPDTPGAAALAEREVAVLRLLADGLSTHQVAVQLNYCER
TIKNIVHDIVTRLKLRNRTHAVAHALRAGLI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcaccggtgaatgtcatttcggtcgcggtggtggcgagcgacccgttgacccgcgat
ggagctttggcccgactctcgtctcaccgggagctcgacgtgcgcgcttggcaggctgga
tgcgaaacctcggtcctgctcgtgctggccaccacgatcaccgcgcctcttctatgccag
atcgaggacgtgcagaaggatggccccagtcacgcgccgaaactggtcgtcgtcgccgac
gaattctccgctgaacaagttttccggatgatcaagctggggttgaccgggttgttgtat
cgcagccagagcacgttcgactgcatcgtcgagacaatccggttgtccgccgaaggccgc
ctgcgactccccgaacgtgtccagcgttacctggtcggccgcatcaagtccaccccgacc
gccgaacctgacacaccgggcgccgccgctcttgccgagcgtgaggtggcggtgctgcgt
ctgctagcggacggcttgagcacgcaccaagtggcggtgcagctcaactattgcgagcgc
acgatcaagaacatcgttcatgacatagtgacgcggctgaagctccgcaaccgcacgcat
gccgttgcacatgcgctgcgcgcgggcctcatttga

DBGET integrated database retrieval system