KEGG   Mycobacterium canettii CIPT 140060008: BN44_10232Help
Entry
BN44_10232        CDS       T02419                                 

Definition
(GenBank) Putative zinc metalloprotease
  KO
K07386  putative endopeptidase [EC:3.4.24.-]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Brite
Enzymes [BR:mcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BN44_10232
Peptidases [BR:mcq01002]
 Metallo Peptidases
  Family M13: neprilysin family
   BN44_10232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M13_N Peptidase_M13 Peptidase_M48 Glyco_transf_18
Motif
Other DBs
NCBI-ProteinID: CCK50117
Position
complement(240143..242134)
Genome map
AA seq 663 aa AA seqDB search
MTLAIPSGIDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATDGAFRSLFDRAEKQVR
DLIIQASQAGAAVGTDAQRIGDLYASFLDEEAVERAGVQPLHHELATLDSAADATELAAA
LGALQRAGVGGGIGVYVDTDSKDSTRYLVHFTQSGIGLPDESYYRDEQHAAVLAAYPGHI
ARMFSLVYGGESRDHAKTADRIVALETKLADAHWDVVKRRDADLGYNLRTFAQLQTEGAG
FDWVSWVTALGSAPDAMTELVVRQPDYLVTFASLWASVNVEDWKCWARWRLIRARAPWLT
RALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAVGKLYVQRHFPPDAKARIDTL
VDNLQEAYRISISELDWMTPQTRQRALAKLNKFTAKVGYPIKWRDYSKLAIDRDDLYGNV
QRGYAVNHDRELAKLFGPVDRDEWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDPQADE
AANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWTDDDRTEFAARTEALIEQYHAYTP
RDLVDHPGPPHVQGAFTIGENIGDLGGLSIALLAYQLSLNGNPAPVIDGLTGTQRVFFGW
AQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRNVDAFYEAFDVTEDDALFLDPQRRVR
IWN
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
gtgacacttgccatcccctcgggtatcgacctgagccacatcgacgctgatgcccgaccc
caagacgacctgttcggccacgttaacggccgctggctggctgaacacgagataccagcg
gaccgggcgaccgacggcgccttccgtagcctgttcgaccgcgccgagaagcaagtgcga
gacctgatcatccaggccagccaagcaggtgctgcggtaggcaccgatgcgcaacgcatc
ggcgacctctacgccagcttcctcgacgaggaagccgtcgagcgcgcaggggtgcaaccg
ctgcaccacgaattggccacgcttgacagcgcggccgacgccaccgaattggccgccgcg
cttggcgccctgcaacgcgccggcgtgggcggcggcatcggagtctatgtcgataccgat
tccaaagactcgacccgttacttggtgcatttcacccaatccggcatcggattacccgac
gagtcctactaccgtgacgagcaacacgccgccgtgctagcggcctatccagggcacatc
gcccggatgttcagcctggtgtacgggggcgagagccgtgaccatgccaagaccgcggac
cgcatcgtcgcgctggagaccaaactcgccgacgcgcattgggatgtggtgaagcgccgc
gacgccgaccttggctacaacctgcgcacgtttgcccagctacagaccgaaggggcgggt
ttcgactgggtcagctgggtgaccgcattggggagcgcaccggacgccatgacggaactg
gttgtgcgccaacctgattacctcgtcacctttgcctcgctgtgggcgagcgttaacgtt
gaagactggaaatgctgggcgcgttggcgtttgatccgtgcccgggccccctggctgacc
cgcgccctggtcgcggaggacttcgaattctacggccgcacgcttaccggcgcacagcag
cttcgggaccgttggaagcgtggggtgtcactggtggagaacctgatgggcgatgccgtc
ggaaagctctatgtacaacggcatttcccgccggacgccaaggcccgcatcgacaccctg
gtggacaacctgcaggaggcgtatcggatcagcatcagcgagctggattggatgacgccg
cagacccggcaacgcgcgctagcgaagctgaacaagttcaccgccaaagtcggctatccg
atcaagtggcgcgactactcgaagctggcgatcgaccgcgacgacctctacggtaacgtc
cagcgcggctacgccgtcaaccatgaccgcgagctagccaagcttttcggcccggtcgac
cgcgacgagtggttcatgacaccacaaaccgtcaacgcctactacaacccggggatgaac
gaaatcgtcttccccgcagcaattttgcagccaccatttttcgatccgcaggccgacgag
gccgccaactacggcggaatcggggcggtgatcggacacgagatcgggcacggtttcgac
gatcagggcgccaaatacgacggggacggcaatctggtcgattggtggaccgacgacgat
cgcaccgagttcgcggcccgcaccgaagcgttgatcgagcaatatcacgcctacacgccg
cgcgatctcgtcgaccatcccggccctcctcatgtacaaggcgcgttcaccataggcgag
aacatcggcgacctgggcgggctgtcgatcgccctgctggcctaccagctgtcgctgaac
ggcaaccccgctccggttatcgacgggctgaccggcacgcaacgggtgttcttcggctgg
gcacaaatatggcgaaccaaatcgcgtgcagccgaggccatccgccggttggcggtcgat
ccgcactccccgccggagttccggtgcaacggtgtggttcgcaacgtggacgctttttat
gaggccttcgacgtcaccgaggatgacgcgctgtttctggacccgcagcgcagggtccgg
atctggaactag

DBGET integrated database retrieval system