KEGG   Mycobacterium canettii CIPT 140060008: BN44_10234Help
Entry
BN44_10234        CDS       T02419                                 

Definition
(GenBank) Conserved membrane protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPP1-like
Motif
Other DBs
NCBI-ProteinID: CCK50119
Position
242833..243522
Genome map
AA seq 229 aa AA seqDB search
MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLLVVEGVAINFWLLRRD
SVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFNRDSREVVHLATGMAET
VASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRGVTAQAATLAAGVEAIGP
SAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSDWLVLDVTPINAR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatgcttggcggctggtggtgttcgatgttctggcaccattggccacgatcgcc
gccctggccgcgatcggcgtcttgctcggctggcccctgtggtgggtatcgacgtgctcg
gtgttggtgctgctggtggtcgaaggtgtggcaatcaacttctggctgttgcgtcgtgat
tcggtaaccgtcggtaccgacgacgatgcgcccgggctgcgactggccgttgtcttcctg
tgcgccgccgcgatctcggcggcggtggtgactgggtacctgcgctggacgacaccggac
cgcgacttcaaccgggattcccgggaagtggtgcatcttgccacggggatggccgagacg
gtcgcgtcgttctccccgagcgcaccggccgccgctgttgaccgggccgcggcgatgatg
gtgcccgaacatgcgggcgggttcaaggagcaatacgccaagtccagcgccgatctcgcc
cggcgcggtgttacggcccaggcggccacgctggcggccggcgtggaggcgatcgggccg
tcggcagccagtgtcgcggtgattctgcgggttagccaaagcattcccggccagccgacc
agtcaagcggcgcgagcgctgcgggtgaccttgaccaagcggggcagcgactggctggtg
ctcgacgtgacgccgatcaacgctcgctaa

DBGET integrated database retrieval system