KEGG   Mycobacterium canettii CIPT 140060008: BN44_10235Help
Entry
BN44_10235        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(243519..244022)
Genome map
AA seq 167 aa AA seqDB search
MTLAAEPHPAPPQQPTVAWSEPDVDRRVEFWPTVAIRSALESADIATWQRIAAALKRDPY
GRTARQVEEVLEGAPATGIANAFWEVLDRARTHLDANERAEVARQVGLLLDRSGLQRQEF
ASRIGVTAQDLTAYLDGSVSPSASLMIRMRRLSDRFVRAKSVRAADS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttggcagccgagccacaccccgcaccgccgcaacaacccaccgtcgcgtggagc
gagccggacgtcgaccggcgggtcgagttctggcctaccgtcgccattcgttcggcgctg
gaaagtgccgacatcgccacctggcaacgcatagcggccgcgctcaagcgcgacccctac
gggcggacagcacgccaagtcgaagaagtcctggagggcgcaccggcgaccggcatcgcc
aacgccttttgggaggtgttggaccgggcccgtactcacctagacgccaacgagcgcgcc
gaggtggcccgtcaagttgggctcctgttggaccgctctggcctgcaacgacaggaattc
gcgtcgcgcattggcgtcacagcgcaggacttgaccgcctacctcgacggcagcgtgagc
ccgtcggcctcgttgatgatccggatgcggcggttgtcggatcggttcgtcagagcgaaa
tccgtacgtgccgccgactcttag

DBGET integrated database retrieval system