KEGG   Mycobacterium canettii CIPT 140060008: BN44_10238Help
Entry
BN44_10238        CDS       T02419                                 

Definition
(GenBank) Conserved membrane protein of unknown function
  KO
K20468  putative heme transporter
Organism
mcq  Mycobacterium canettii CIPT 140060008
Brite
Transporters [BR:mcq02000]
 Other Transporters
  Others
   BN44_10238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPG_synthase_TM
Motif
Other DBs
NCBI-ProteinID: CCK50123
Position
complement(247603..248841)
Genome map
AA seq 412 aa AA seqDB search
MSHDAPARNLRQRVGALPRTRVGAPPAEGVPPRGKYWWLRWAVLAIVAIVLAIEVALGWD
QLAKAWVSLYRAKWWWLLAAVAAAGASMHSFAQIQRTLLKSAGVHVKQWRSEAAFYAANS
LSTTLPGGPVLSATFLLRQQRIWGASTVVASWQLVMSGVLQAVGLALLGLGGAFFLGAKN
NPFSLLFTLGGFVTLLLLAQAVASRPELIEGIGRRVLSWANSVRGRPADAGLPKWRETLM
QLESVSLGRRDLGVAFGWSLFNWIADVACLGFAAYAAGDHASVGGLAVAYAAARAVGTIP
LMPGGLLVVEAVLVPGLVSSGMPLPSAISAMLIYRLISWLLIAAIGWVVFFFMFRTESTA
DSDNDRDPPTDPNLRLVIQPQGTPCDDPVETTPQGPAPTPDLRPEGGETPPR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcacgacgcccccgcccgcaacctccgccagcgcgtgggggcactccctcgcacg
cgggtgggggcaccccccgctgagggcgtacccccgcgcggcaagtactggtggttgcga
tgggcggtactggccatcgtcgcaatcgtgcttgctatagaggtggcgttgggctgggac
cagctcgccaaggcctgggtgagcttgtatcgcgccaagtggtggtggttgctggccgcg
gtggcagccgcgggcgcctcgatgcacagcttcgcccagattcagcgaaccctgctgaaa
tccgccggggtgcacgtcaagcaatggcggtcggaggccgccttctacgccgccaactcg
ctgagcaccacgctgccgggtgggccggtgttgtcggctacgttcttactccgtcagcaa
cgcatctggggcgcctcgacggtggtggcgtcatggcagctggtcatgtcgggcgtgttg
caggcggtgggcttggcattgctcgggttgggtggcgcattcttcctgggcgccaagaac
aacccgttctcactgctgttcaccctgggcggcttcgtcacattgctgctactggcccag
gcggtggcgtcgcggccggagctcatcgaggggatcggcaggagagttttgtcgtgggcc
aactcggttcgcggtaggccggccgatgccggcctaccgaagtggcgcgagacgctcatg
cagctggaatcggtcagcctgggcaggcgcgacctgggcgtggcgttcggttggtcgttg
ttcaactggatcgccgacgtagcctgcctcggtttcgccgcgtacgccgccggcgaccat
gcctcggtcggtgggctggcggtcgcctacgccgccgcccgcgcggtcggcaccataccg
ctgatgcccggtggtctgttggtggtcgaggcggtgctggtacccggcctggtatccagc
ggcatgcccttgccgagtgccatctcggcgatgttgatctaccggctgatcagctggctg
ctcatcgccgcaatcggctgggtggtgttcttcttcatgttccgcaccgagagcaccgcc
gattccgacaacgatcgcgacccgccaaccgatccaaacctgcgacttgtcatccaaccg
cagggcacaccctgcgacgacccggtcgaaaccacaccgcaaggtccagcgccgacccct
gacctgcgaccagaaggcggcgagacaccgccccggtag

DBGET integrated database retrieval system