KEGG   Mycobacterium canettii CIPT 140060008: BN44_10244Help
Entry
BN44_10244        CDS       T02419                                 

Definition
(GenBank) Conserved membrane protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Activator-TraM
Motif
Other DBs
NCBI-ProteinID: CCK50129
Position
255747..257225
Genome map
AA seq 492 aa AA seqDB search
MIRAASDDPAGVDELVAAIAPGLAGLGLPVINRREVVLVTGPWLAGVSGVRAALAERLPQ
RRFVETAELGPGDAPVAVVFVVSAATALTESDCVLLDTAAEHTDAVVAVVSKIDVHRGWR
DVLTSNRDRLAARASRYARVPWVGAAAAPELGEPYLDDLVAAIQKQLADPAVARRNMLRA
WESRLLMVARRFDGDAQSAGRRARVDALRQQRRTVLRQGRQSKSEHTIALRAQIQHARVK
LSYFARNRCSLLRVELQEHVAGLSRKDIARFAAYTRGRVQEVVAEVGEGAVAHLADVAQL
LGVPVQPPVLENLPAVLPTVAAPPLTSRRLEIRLTTLLGAGFGLGIALTLSRLVAGLTPG
LAASGMVAGVAIGLAVTAWVVNARALLHDRVVVDRWTGEVTASLRSVVEQLVATRVVAVE
TLLSTAISERDDAENARVADQVSIIDGELREHAVAAARAAALRDREMPAVRAALEAVRAE
LGEPGTPTTGLF
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcgcggctagtgatgacccggccggggtggacgagctggtggcagcgatcgcg
ccggggcttgccgggctgggtttgccggtcatcaaccgccgcgaggtggtgctggtgacc
ggtccgtggctggccggggttagcggtgtgcgcgcggcactggccgaaaggctgccgcag
cgtaggttcgtcgagacggcagagttgggacccggcgatgcgccggtggcggtggtgttc
gttgtttccgcggcaaccgcgctgaccgaatccgattgcgtgttgctggacaccgccgcg
gagcacaccgatgcggtggtagctgtggtgtccaagatcgacgtgcaccgcggctggcgt
gacgtgcttaccagtaaccgcgacaggctggccgcgcgcgcgtcccgctacgcccgggtg
ccctgggttggcgcggccgccgcacctgagctgggcgagccatacctggacgacttggtc
gccgccatccagaaacagctcgccgatccggctgtcgcgcggcgaaacatgttgcgtgcg
tgggaatcccggcttctgatggtcgcgcggcggttcgatggcgatgcacagagcgccggt
cggcgggcacgggtcgacgcgttgcgccagcaacggcgcacggtcctgcggcaggggcgt
caatcgaagtctgaacacaccatcgcgctgcgcgcgcagatccagcacgctcgggtcaaa
ttgtcctactttgcccgcaatcggtgttcgttgctgcgcgtcgagctgcaggagcacgtc
gccggtctgtcccggaaggacatcgccaggttcgcggcatacacgcgcggccgggtccag
gaggtggtcgccgaggtgggcgaaggtgccgtcgcgcaccttgccgacgtcgcgcagctg
ttgggtgtgccggtgcagccaccggtcctcgagaacctcccggcggtgctcccgacggtt
gcggccccgccactgacatcacgacgattggagatccggctgacaacactcttgggcgcc
gggttcgggctgggtatcgcgctgaccctgagcaggctggtggcgggtcttactcccggc
ctggctgcatcggggatggtggcgggtgtggcgatcggcctggcggtgaccgcctgggtg
gtgaatgcccgcgcgctgctgcacgaccgtgtcgtggtggaccgctggacgggtgaggtg
acggcatcgctgcggtccgtggtggagcagctggtcgccactcgggtggtggctgtcgag
acgctgctgagcaccgcgattagtgaacgcgacgacgccgagaacgcccgggtggccgat
caggtcagcatcattgacggcgaactgcgcgaacacgccgtcgctgcggcgcgggccgcg
gccctgcgtgaccgggagatgccggcggtgcgggccgcacttgaggcggtgcgtgcagaa
ctcggcgagccgggtacgcccacaacagggctgttctga

DBGET integrated database retrieval system