KEGG   Mycobacterium canettii CIPT 140060008: BN44_10248Help
Entry
BN44_10248        CDS       T02419                                 

Gene name
fadD
Definition
(GenBank) Putative fatty-acid-CoA ligase FadD4 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
261691..263304
Genome map
AA seq 537 aa AA seqDB search
MPRGELYKRFRLVMGGIAPCGSGRRAATYPRRMQIRPYIGADKPAVILYPSGTVISFDEL
EARANRLAHWFRQAGLREDDVVAILMENNEHVHAVMWAARRSGLYYVPINTHLTASEAAY
IVDNSGAKAIVGSAALRETCHGLAEHLPGGLPDLLMLAGGGLVGWMTYPECVADQPDTPI
EDEREGDLLQYSSGTTGRPKGIKRELPHVSPDAAPGMMPALLDFWMDADSVYLSPAPMYH
TAPSVWTMSALAAGVTTVVMEKFDAEGALDAIQRYRVTHAQFVPAMFVRMLKLPEAVRNS
YDMSSLRRVIHAAAPCPVQIKEQMIHWWGPIIDEYYASSEASGSTLITAEDWLTHPGSVG
KPIQGGVHIVGADGSELPPNQPGEIYFEGGYPFEYLNDPAKTAASRNKHGWVTVGDVGYL
DDDGYLFLTGRRHHMIISGGVNIYPQEAENLLVAHPKVLDAAVFGVPDDEMGQRVMAAVQ
TVDSADANDQFAGELLAWLRDRLSHFKCPRSIAFEPQLPRTDTGKLYKSGLVEKYSV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
ttgccacgtggagaactttacaaacgatttcggctggtgatgggcggaattgcgccctgc
ggctctggtcgccgggccgcgacgtaccctcggcgcatgcagattcgcccgtatatcggc
gccgataagcccgccgtcatcctgtatccgtccgggacggtcatcagcttcgacgagttg
gaggcccgcgccaaccggttggcgcattggttccgccaggctggtctgcgcgaggacgac
gtcgtggccatcctgatggagaacaacgagcacgtgcacgcggtcatgtgggcggctcgc
cgcagcgggttgtactacgtgccgatcaatacccacctgaccgcctccgaggccgcctac
atcgtcgacaacagcggtgccaaagcaattgtcggttcggcggcgctgcgcgagacctgc
cacggcctggccgaacaccttccgggcgggctgccggacctgctgatgcttgccgggggc
ggtctggtcggctggatgacctacccggaatgcgttgccgatcaaccagacaccccgatc
gaggacgaacgcgagggtgacctgctgcagtactcgtcgggaacgactggccgaccgaag
ggaatcaaacgcgaattgccacacgtctcaccggatgcggcacccgggatgatgccggca
ctgctcgatttctggatggacgccgactcggtatatctgagtcccgcgccgatgtaccac
accgctccgtcagtgtggacgatgagcgcactggccgcgggcgtcaccaccgtcgtgatg
gagaagttcgacgccgagggcgccctcgacgccatccagcgctaccgggtgacccacgcg
caattcgtcccggccatgttcgtccggatgctgaaactccctgaagcagttcgtaattcg
tatgacatgtccagccttaggcgagtgatccacgcggccgctccatgtccagtccagatc
aaggagcagatgattcactggtggggaccgatcatcgacgagtactacgcctcctcggaa
gccagcgggtcgacgttgatcacagccgaggattggttgacgcatccgggttcggtcggc
aagcccatacagggcggggtgcacatcgtgggcgccgacggcagcgagctgccgccgaac
cagccgggcgaaatctatttcgagggcgggtaccccttcgaatacctcaacgatccggcg
aaaaccgcggcgtcgcgcaacaagcacggctgggtaaccgtcggcgacgtcggctatctc
gacgacgacggctacttgttcctgaccggccggcgccaccacatgatcatctccggcggc
gtgaacatctacccgcaggaggcggagaacctcttggtcgcccaccccaaggtgctcgac
gcggcggtgttcggcgttcccgacgacgagatgggtcaacgtgtcatggccgcggtgcaa
accgtcgactccgccgatgccaacgatcagttcgccggcgagctattagcctggttacga
gaccgcttgtcacacttcaagtgtccaaggtcgatcgcgttcgaaccgcaattgccgcgc
accgacaccggaaagctctacaagagcgggctggtcgaaaaatactcggtgtga

DBGET integrated database retrieval system