KEGG   Mycobacterium canettii CIPT 140060008: BN44_10251Help
Entry
BN44_10251        CDS       T02419                                 

Gene name
lipW
Definition
(GenBank) Putative esterase LipW
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(265579..266487)
Genome map
AA seq 302 aa AA seqDB search
MSGNEVHPDLRRIAVVTPRQLVGPRTLPVMRALIVVAGLRMSRTPPDIEVLTLESGVGVR
LYRPAGSNEPAPALLWIHAGGYVMGTAQQDDRLCLRFSSRLGITVASVDYRLAPENPYPA
ALGDCYSALTWLASLPAVDPARVAIGGASAGGGLAAALALLARDRGGITPAFQLLVYPML
DDRTSIAPANPHYRLWNGRANRFGWRAYLGDADARVAVPGRRDDLGGLAPAWIGVGTHDL
LHDEDLAYAERLTAAGVPCQVEVVEGAFHGFDRVAPNVGVSQRFFTSQCNSLRAALALSN
RT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggcaacgaagtccaccccgacctgcgtcgcatcgccgtcgtcaccccacgacag
ctggtcggtcctcgcaccctgccagtcatgcgggcattgatcgtcgtcgcggggcttcga
atgtcccgtacaccccccgatatcgaggtgctcaccctggaatccggggtcggtgtccgg
ctataccgacccgccggcagcaacgaaccagcgcccgcgctgctgtggatccacgccggc
ggatacgtaatgggcaccgcgcaacaggacgatcggctctgcctccggttcagcagcaga
ctgggcatcactgtcgcatcggtggactaccgcctggcgccggaaaatccgtatcctgcc
gccctgggcgactgctactcggcgttgacctggctggccagcctgccggcggtggacccc
gcgcgggtggcaatcggcggcgctagtgccggcggcggcctcgcggcggcgctggctctg
cttgcccgcgaccgtggcggcatcacaccggcatttcagttgctggtgtaccccatgctc
gacgaccggacgtcgatcgcccccgccaacccgcactaccggctatggaacgggcgcgcc
aaccggttcggctggcgggcatatcttggcgatgcggacgcacgggtcgcggtcccggga
cggcgtgacgacctaggagggctggcgccggcatggatcggcgtcggcacccacgacctg
ctccacgacgaggatctggcctatgccgaacgtctgacagcagccggggtgccatgccag
gtagaagtagtcgaaggcgccttccacggtttcgatcgtgtggccccgaatgttggggtc
tcacaaaggttcttcactagtcagtgcaacagtttgcgtgccgcgctggcccttagtaac
cgaacctag

DBGET integrated database retrieval system