KEGG   Mycobacterium canettii CIPT 140060008: BN44_10252Help
Entry
BN44_10252        CDS       T02419                                 

Definition
(GenBank) Conserved membrane protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_molyb Ni_hydr_CYTB DUF3236
Motif
Other DBs
NCBI-ProteinID: CCK50137
Position
266580..267908
Genome map
AA seq 442 aa AA seqDB search
MSDPARGAEAEDAYGFPAGLWRWLQRHPPPALHRLTRFRSPLRGPWLTSVFGLVLLVALP
FVIITGLLSYIAYAPQLGQAIPGDVGWLRLPAFTWPTRPSWLYRLTQGLHVGLGLVIIPV
VLAKLWSVIPRLFVWPPARSIAQVLERLSVLMLVGGILFQIVTGVLNIQYDYIFGFSFYT
GHYFGAWVFIAGFLLHIVVKIPHMVTGLRSIPMREVLGTNVADTRAQPCDPDGLVSVNPG
EATLSRRGALGLVGAGVLLIGVLTVGQTLGGFTRKAALLLPRGRVVSPGDFPVNKTAAAA
GITAEAIGPDWRLVLRGGPAEVVLDRATLAGLPQRTARLPLACVEGWSAVRTWSGVPLAE
LALLAGVPAARSARVTSLQRGGAFGEAKLAANQIADPDALLALRVDGADLSLDHGYPARI
IVPALPGVHNTKWVAGIEFHKR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatccagcaagaggggcggaagccgaggatgcctacggttttcccgccgggctg
tggcgctggctgcagcggcatccaccgccggcgttgcaccggctcacccggtttcgcagc
ccgttgcgtggtccgtggttgacgtcggtgttcggcctggtgctattggtggcgttgcct
ttcgtcatcatcaccgggctactttcttatatcgcctatgcgccgcagctgggccaggcc
atccccggtgacgtcggctggctgcgactccccgctttcacctggcccacccgtccgtcc
tggctgtaccggttgacccaggggctgcatgtggggctggggctggtgatcattcccgtg
gtgctggccaagttgtggtcggtgataccgcggctgtttgtgtggccgccggcgcgctcg
attgcccaggtgctcgaacggttgtcggtgctgatgctggtcggtgggatcctgttccag
atcgtcaccggcgtgctcaacattcagtatgactacatcttcgggttcagcttctacacc
ggccactattttggggcttgggtcttcattgcgggtttcctgttgcatatcgtggtcaag
atcccccacatggtcaccgggttgcgatcgataccgatgcgagaagtgttgggtaccaac
gtggctgacacccgggcgcagccgtgcgatccggacgggctggtgtcggtcaatccgggc
gaggccacgctaagcagacgcggtgccctgggattggtcggtgccggggtgctgctgatc
ggggtgctgacggttgggcaaaccctgggcgggttcacccgcaaggccgccctgctgctg
ccccggggccgtgtcgtgagcccgggcgacttcccggtcaacaagaccgccgccgccgcc
gggatcaccgcggaggccattggccccgactggcggctggtgctgcgtggcgggcctgcg
gaagtagtgctggatcgcgccacgctggccggcctgccgcaacgcaccgcccggctgccg
ctggcctgcgtcgaagggtggtcggccgtgcgcacctggagcggcgtgccgctggccgag
ctggcgctgctggcgggcgtgccggcggcgcgctcggcacgggttacatcgctgcagcgc
ggcggggcgttcggcgaggcgaagctggcggcaaaccagatcgccgaccccgatgcgctg
ctggcgttgcgggtcgacggggcggatctgtcgctggatcatggctacccggcccgcatc
atcgttcccgcactgcccggtgtgcacaacacgaaatgggtcgctggcatcgaattccac
aagaggtga

DBGET integrated database retrieval system