KEGG   Mycobacterium canettii CIPT 140060008: BN44_10255Help
Entry
BN44_10255        CDS       T02419                                 

Definition
(GenBank) Putative triacylglycerol synthase (diacylglycerol acyltransferase)
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
269723..271132
Genome map
AA seq 469 aa AA seqDB search
MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFREVIAGRLHKLEPLGYQ
LVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVGEIASTPLNRDHPLWEM
YFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEVGRYVPDPAPTKRQLLSA
AFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFTPPPTFMNHRLTPERRFAT
ATLALIDVKATAKLLGATINDMVLAMSTGALRTLLLRYDGKAEPLLASVPVSYDFSPERI
SGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLLGPELISRWAAYWPPAGAEAL
FRWLSERDGQNKVLNLNISNVPGPRERGRVGAALVTEIYSVGPLTAGSGLNITVWSYVDQ
LNISVLTDGSTVQDPHEVTAGMIADFIEIRRAAGLSVELTVVESAMAQA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggctcagcggctgggacgcggtactgctttacagcgagaccccgaatgtgcac
atgcacacactcaaggtcgccgtgatcgaattggattcggacagacaggaattcggtgtc
gacgcgtttcgcgaggtgatcgctggccggctgcataagcttgagccattgggctatcag
ctggttgatgtcccgttgaagttccatcacccgatgtggcgggagcactgccaggtcgat
ctcaactaccacatccggccgtggcggttgcgcgccccggggggtcggcgcgaactcgac
gaggcggtcggagaaatcgccagcaccccgctgaaccgcgaccacccgctgtgggagatg
tacttcgttgaggggcttgccaaccaccggatcgcggtggttgccaaaattcaccatgcg
ttggctgacggtgttgcctcggcaaacatgatggcacgggggatggatctgctgccggga
ccggaggtcggccgctatgtgcctgaccccgctcctaccaagcggcagttgctgtccgcg
gcgttcatcgaccacttgcgccacctcggccggattcctgcaaccatccggtacaccacg
cagggtctaggccgggtgcgacgtagctcgcgcaagctctcacccgcactgaccatgcca
tttaccccgccaccgacgttcatgaatcaccggctcaccccggagcgcaggttcgccacc
gccaccctggcgctgattgacgtgaaggcgacggccaagttgctgggggcgacgatcaac
gacatggtgctggccatgtcgaccggcgctctgcgtaccctgctattgcgctatgacggc
aaggccgaaccgctgctggcgtcggtcccggtgagttacgacttctcaccggagcggatc
tccggtaaccgcttcaccggaatgctggtggcgctgcctgccgactccgacgacccgttg
cagcgggtgcgcgtctgtcacgaaaacgcggtctccgccaaggagagccaccagcttttg
ggaccggagttgatcagccgctgggcggcttactggccacctgccggtgcggaagccttg
ttccggtggttgtctgagcgcgacgggcagaacaaggtactcaacttgaatatctcgaat
gttcccggtccgcgcgaacgcggccgcgtgggggccgcgctggtcaccgagatctattcg
gtgggcccgttgaccgcaggtagcggattgaatatcacggtgtggagttatgtcgatcag
ctcaatatctcggtgttaaccgatggttccaccgtgcaggacccgcatgaagtaaccgcg
ggaatgatcgcggacttcatcgaaatacgccgcgccgctggtctttccgtggagttgaca
gtcgtcgagtccgcgatggcgcaggcatga

DBGET integrated database retrieval system