KEGG   Mycobacterium canettii CIPT 140060008: BN44_10258Help
Entry
BN44_10258        CDS       T02419                                 

Definition
(GenBank) Putative methyltransferase
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran Peptidase_M66
Motif
Other DBs
NCBI-ProteinID: CCK50143
Position
complement(273519..274283)
Genome map
AA seq 254 aa AA seqDB search
MAVTDVFARRATLRRSLRLLADVRYEQRDPARFYRTLAADTAAMIGDLWLATHSEPPVGR
TLLDVGGGPGYFATAFSDAGVGYIGVEPDPDEMHAAGPAFTGRPGMFVRASGMALPFADD
SVDICLSSNVAEHVPRPWQLGTEMLRVTKPGGLVVLSYTVWLGPFGGHEMGLSHYLGGAR
AAARYVRKHGHPAKNNYGSSLFAVSAAEGLRWAAGTGAALAVFPRYHPRWAWWLTSVPVL
REFLVSNLVLVLTP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtcaccgatgtgttcgcgcgacgggcgacactgcggcgctcgctgcgactgctg
gcagacgtccgctacgagcagcgcgacccggcacggttctatcgcacactggcggccgac
accgcagcaatgatcggcgatctgtggctggccacacatagcgagccgccagttggccgt
acgctgctcgacgttggcggcgggccggggtatttcgcgacggcgttctccgacgccggt
gtcggctacatcggcgtcgagccggaccctgatgaaatgcatgccgccggacctgcgttc
accggccggcccggcatgttcgtccgggcgtcaggcatggcactgccgttcgccgacgac
tcggtagacatctgcttgtcctccaatgtcgccgaacacgtgccgcgcccctggcagctt
ggcaccgagatgctgcgggtgaccaagccaggcgggttggtcgtgctgtcctacacggtt
tggctggggccattcggcgggcacgagatgggcctcagccactacctcggcggcgcccgc
gccgccgcccgatatgtccgcaaacacggccatccggcaaagaacaactatgggtcgtcg
ttgtttgccgtgtccgccgccgagggtctgcgctgggctgccggcaccggagccgcgtta
gccgtatttccccgctaccaccccagatgggcgtggtggctgacatccgtcccggtgctg
cgtgagttcctggtgagcaatctggtattggtgctcacaccctaa

DBGET integrated database retrieval system