KEGG   Mycobacterium canettii CIPT 140060008: BN44_10261Help
Entry
BN44_10261        CDS       T02419                                 

Definition
(GenBank) Conserved membrane protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(277230..278495)
Genome map
AA seq 421 aa AA seqDB search
MLRFAACGAIGLGAALLIAALLLSTYTTSRIAEIPLDIDATLISDGTGTALDSASLATEH
IVVNQDVPLVSQQQVTVESPANADVVTLQVGSSLRRTDKQKDSGLLLAIVDTVTLNRKTA
MAVSDDTHTGGAVQKPRGLNDENPPTAIPLRHDGLSYRFPFHTEKKTYPYFDPIAQKAFD
ANYEGEEDVNGLTTYRFTQNVGYTPEGKLVAPLKYPSLYAGDEDGKVTTSAAMWGLPGDP
NEQITMTRYYAAQRTFWVDPVSGTIVKETERANHYFARDPLKPEVTFADYQVTSTEETVE
SQVNAARDERDRLALWSRVLPITFTAAALVALVGGGLFASFSLRTEGALMAASGDRDDHD
YRRGGFEEPVPGAEAETEKLPTQRPDFPREPSGSDPPRLGSAQPPPPPDAGHPDPGPPER
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggttcgccgcgtgcggcgctatcggactcggagccgccctactgatcgccgcc
ctgctgctgtcgacctataccaccagcaggatcgctgagatcccactcgatatcgatgcc
acgttgatcagcgacggcactggaacggcactcgactcggcgtcgctagccaccgagcac
atcgtggtcaaccaggacgtgccgctggtgtcccaacagcaagtcaccgtcgaatcgccc
gccaacgccgacgtggtcacacttcaggtcggatcctcgctccggcgcaccgacaagcag
aaggacagcgggctgctgctggcgatcgtcgacacggtcaccctcaaccgcaagacggcg
atggctgtctccgacgacacccacaccggcggcgccgtccagaaaccgcggggcctcaat
gacgagaacccgccgacggccattccgctgcggcacgacgggctgtcttaccggttcccg
tttcacaccgagaagaagacatacccctatttcgaccccatcgcacagaaggcgtttgac
gccaactacgaaggcgaggaggacgtcaacggtttaaccacataccgcttcacgcagaac
gtcggctacacccccgaggggaagctggtggctcccctcaaatacccgtcgctgtacgcc
ggcgacgaggacggcaaagtcaccacatcagcggcgatgtgggggctacccggtgatccg
aacgagcaaatcaccatgacccgctattacgcggcgcagcgaacattctgggtggacccg
gtgtccggcaccatcgtcaaagaaaccgaacgcgccaaccactacttcgctcgtgaccca
ctcaaaccagaggtcacgtttgccgactaccaggtcacctccaccgaagagacggtcgaa
tcccaggtcaacgcggctcgcgacgagcgcgaccggctggcgctgtggtcgcgggtgctg
ccgattacattcaccgcggccgccttggtcgcgctggtcggcggtggtctgttcgcgtcg
tttagccttcggaccgaaggtgcgctgatggctgccagcggggatcgggacgaccacgat
taccgccgcggcggcttcgaagaaccggtgcctggagcggaggctgagaccgagaaactg
cccacgcagcgccccgacttcccgcgcgagccgagtggctcggatccgccccgactcggt
tcggcgcagccgcccccaccgccggacgcggggcatcccgaccccggcccgcccgagcgg
cgctaa

DBGET integrated database retrieval system