KEGG   Mycobacterium canettii CIPT 140060008: BN44_10262Help
Entry
BN44_10262        CDS       T02419                                 

Definition
(GenBank) Putative integral membrane acyl transferase
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 DUF357
Motif
Other DBs
NCBI-ProteinID: CCK50147
Position
278711..279934
Genome map
AA seq 407 aa AA seqDB search
MGPADESGAPIRPQTPHRHTVLVTNGQVVGGTRGFLPAVEGMRACAAVGVVVTHVAFQTG
HSSGVGGRLFGRFDLAVAVFFAVSGFLLWRGHAAAARDLRSHPRTGPYLRSRVARIMPAY
VVAVVVILSLLPDADHASLTVWLANLTLTQIYVPLTLTGGLTQMWSLSVEVAFYAALPVL
ALLGRRIPVGARVPAIAALAALSWAWGWLPLDAGSGINPLTWPPAFFSWFAAGMLLAEWA
YSPVGLPHRWARRRVAMAVTALLGYLVAASPLAGPEGLVPGTAAQFAVKTAMGSLVAFAL
VAPLVLDRPDTSHRLLGSPAMVTLGRWSYGLFIWHLAALAMVFPVIGAFPFTGRMPTVLV
LTLIFGFAIAAVSYALVESPCREALRRWERRNEPISVGELQADAIAP
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggcccggcggacgaatcgggtgcaccgattcgcccgcaaacacctcacaggcacact
gtgttggtgaccaacggccaggtggtgggtgggacccgtggctttctgcccgccgtcgag
ggaatgcgcgcatgcgcggccgtcggcgtcgtggtcactcacgtcgcgttccagaccggg
cactctagcggtgtgggcgggcggctgttcggccgcttcgatctggcggtggcggtgttc
ttcgccgtgtcgggattcttgttgtggcgcggacacgccgcagcggcgcgagatctgcgg
tcacacccgcgaaccggtccgtatctgcgatcgcgggtggcgcgcatcatgccggcctat
gtggtggcggtggtcgtcatcctgtccctgctgcccgacgcggatcatgccagcctgacc
gtgtggctggccaacctgacgctcacccagatctatgtgccgctgaccctgaccggcggc
ctgacccagatgtggagcctgtccgtggaggtcgccttctatgcggcgctgccggtctta
gcgttgctgggccgccgaattccggtcggtgcccgagtgccggcgatcgcggcgctggcg
gcgctcagctgggcgtggggctggctcccgttggacgccgggtcggggatcaacccgttg
acctggccgccggcgttcttctcgtggttcgccgcgggaatgttgctggcggagtgggcc
tacagcccggtcgggttgccgcatcggtgggcgcgccgccgcgtggcgatggcggttacc
gcgctgctgggttacctggtggcggcctcgccgttggcgggtccggagggcctggttccg
ggcacggcggcacaattcgcggtgaagaccgcgatgggctcgctggtagcgttcgcgctg
gtggcgccgctggtgctggaccggcccgacacgtcgcaccggctgctgggcagccccgcg
atggtgaccctgggccgttggtcctatggcctgttcatctggcatctggccgcgctggcc
atggtgtttcccgtgatcggagcgttcccgtttaccgggcgaatgccgacggtgctggtg
ttgacgctgatcttcggtttcgcgatcgccgcggtcagctacgccctggtcgagtcgccc
tgccgggaagcgttgcgccgctgggagcgccgcaacgaacccatatcggtcggcgaactt
caggcggacgcgattgcaccctga

DBGET integrated database retrieval system