KEGG   Mycobacterium canettii CIPT 140060008: BN44_10269Help
Entry
BN44_10269        CDS       T02419                                 

Gene name
gabD
Definition
(GenBank) Putative succinate-semialdehyde dehydrogenase [NADP+] dependent (SsdH) GabD1
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00250  Alanine, aspartate and glutamate metabolism
mcq00310  Lysine degradation
mcq00350  Tyrosine metabolism
mcq00650  Butanoate metabolism
mcq00760  Nicotinate and nicotinamide metabolism
mcq01100  Metabolic pathways
mcq01120  Microbial metabolism in diverse environments
Module
mcq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BN44_10269 (gabD)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN44_10269 (gabD)
   00310 Lysine degradation
    BN44_10269 (gabD)
   00350 Tyrosine metabolism
    BN44_10269 (gabD)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BN44_10269 (gabD)
Enzymes [BR:mcq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     BN44_10269 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     BN44_10269 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     BN44_10269 (gabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Acetyltransf_6
Motif
Other DBs
NCBI-ProteinID: CCK50154
Position
complement(285261..286634)
Genome map
AA seq 457 aa AA seqDB search
MPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARWANATADLLEA
EADQAAAMMTLEMGKTLAAAKAEALKCAKGFRYYAENAEALLADEPADAAKVGASAAYGR
YQPLGVILAVMPWNFPLWQAVRFAAPALMAGNVGLLKHASNVPQCALYLADVIARGGFPD
GCFQTLLVSSGAVEAILRDPRVAAATLTGSEPAGQSVGAIAGNEIKPTVLELGGSDPFIV
MPSADLDAAVSTAVTGRVQNNGQSCIAAKRFIVHADIYDDFVDKFVARMAALRVGDPTDP
DTDVGPLATEQGRNEVAKQVEDAAAAGAVIRCGGKRLDRPGWFYPPTVITDISKDMALYT
EEVFGPVASVFRAANIDEAVEIANATTFGLGSNAWTRDETEQRRFIDDIVAGQVFINGMT
VSYPELPFGGVKRSGYGRELSAHGIREFCNIKTVWIA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatcgccaccatcaacccggctaccggcgaaacagtcaagacattcactgcggcg
accgatgacgaagtcgacgcggcaatagcccgggcccaccggcggttcgccgactaccgc
cagaccagcttcgcccagcgcgcccggtgggccaatgccaccgccgacttgctggaagcc
gaggccgaccaggccgccgcgatgatgacgctcgagatgggcaagacgctggccgcggcc
aaagccgaggcactgaagtgcgccaagggttttcgctactacgccgaaaacgccgaggcg
ttgctggccgacgaacccgccgatgcggccaaggtcggggcgtcggcggcctacggccga
taccagccgctcggggtgatcctggcggtgatgccatggaacttccccctgtggcaagcg
gttcggttcgccgcaccggcactgatggccggaaacgtcggcctgctcaagcacgcgtcg
aacgtgccgcaatgcgcgctgtacctggccgacgtcatcgcccgaggcggcttcccggac
ggctgcttccagacgttgcttgttagctcgggagccgtcgaagccatcctgcgtgatccc
cgggtcgcggcggccacgctgaccggaagcgagccggccggccaatcggtgggcgctatc
gccggtaacgagatcaagccgaccgtgctcgagctcggcggcagcgacccgttcatcgtt
atgccgtcggccgatctggacgccgcggtcagcaccgccgtcaccggccgggtgcagaac
aacggccaatcctgcatcgccgccaagcggttcatcgtccacgccgacatttacgacgat
ttcgtcgacaagttcgtcgcgcggatggcggcgttacgggtcggcgacccgaccgacccg
gacaccgacgtgggcccgctggccaccgagcagggccgcaacgaggttgccaagcaagtc
gaggatgctgccgcggcgggcgcggtgatccggtgcggcggaaagcgtctcgaccggccg
ggctggttctacccgccgaccgtgatcaccgacatctccaaggacatggctctctacacc
gaggaggtcttcggtccggtcgcctcggtgttccgcgcggcgaacatcgacgaggccgtc
gagatcgccaacgccaccaccttcgggctgggatccaacgcctggacccgcgacgagacc
gagcaacgacgcttcatcgacgacatcgtggcgggccaggtttttatcaacggcatgacg
gtgtcctatcccgaattgccgttcggcggggtcaagcgctcgggctatggccgggaactg
tccgcacacgggatacgcgagttctgcaacatcaagaccgtctggatcgcctag

DBGET integrated database retrieval system