KEGG   Mycobacterium canettii CIPT 140060008: BN44_10272Help
Entry
BN44_10272        CDS       T02419                                 

Definition
(GenBank) Conserved exported small protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(292554..292727)
Genome map
AA seq 57 aa AA seqDB search
MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggatcgtcgcgcccgccgccgcaagcgtggtggttggtctgttgctgggcgcg
gccgcgatcttcggagtgaccctgatggtgcagcaggacaagaaaccgccactccccggg
ggcgatccgtcgtcatcagtgctcaaccgggtcgagtacggtaaccgtagctag

DBGET integrated database retrieval system