KEGG   Mycobacterium canettii CIPT 140060008: BN44_11042Help
Entry
BN44_11042        CDS       T02419                                 

Definition
Putative formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mcq03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052640..1053503
Genome map
AA seq 287 aa AA seqDB search
MPELPEIEALADHLRRHAVGTTVGRVDVGALSALKTFDPPVDALYGQTVAGADRWGKYLG
LSTGRLWLITHLSRAGWLRWSDKLTAVPLRPGKGPIALRVHLGVPGTAPGFDLTEAGTQK
RLAVWLVDDPKRVPGIAALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYS
DEILHVAKISPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVH
ARTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaactgcccgagatcgaagcgctggcagatcatttgcgccggcacgccgtcggt
acgacggttggccgtgtcgatgtcggcgcgctgtccgcgctgaaaaccttcgatccgccg
gtggacgcgctgtacggccagacggtggcgggggccgatcggtggggtaaatacctcggc
ctgtcgaccgggcggctgtggttgatcacccacctgtcccgggcgggctggttgcgctgg
tccgacaagctgaccgcggtgccgctgcgccccggcaaggggcccatcgcgctgcgcgtc
cacctgggcgtcccgggcaccgcgccgggtttcgacctcaccgaggcaggaacccagaaa
cggctggcggtgtggctggtcgacgatccgaagcgggtgcccggcatcgccgcgctcggg
cccgatgcgctggacgtcagcaccgacgacctggccgggctgttggccggcaacaccggc
cggatcaagaccgtcatcaccgaccagaaggtgatcgccggcatcggcaacgcctatagt
gacgaaatcctgcacgtcgcgaagatctcgccgttcgccacggccggcaagttatccggc
gcacagctcacctgcctgcatgaggcgatggcgtcggtgctgtcggacgcggtgcgccgg
tccgtcggccagggcgcggccatgctcaaaggggagaaacgttctgggcttcgagtacat
gcgcgcaccgggttaccctgcccagtgtgcggtgacaccgtgcgggaggtgtccttcgcg
gacaagtcttttcagtactgtccaacgtgtcagaccggtggcaaggcgctggccgaccgg
cgtatgtcgcggctgctcaagtag

DBGET integrated database retrieval system