KEGG   Mycobacterium canettii CIPT 140060008: BN44_120130Help
Entry
BN44_120130       CDS       T02419                                 

Definition
(RefSeq) hypothetical protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4198168..4199208)
Genome map
AA seq 346 aa AA seqDB search
MAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGGPMLTALRDRPTHL
QRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADALKVTHPAAIVWAAQMGTITL
HPWQVRCPDTEHPDELRIDLDPQPGTGFVEARTVAVDVLRSVLDDLGLVGYPKTSGGRGI
HVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTM
ASAYSVRPTPIATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPWAGMDDVAQSIAPL
LDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKGGNTSK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagctgaggaactcgacgtcgacggcatcgcggtgcggttgactagcccg
gacaggatgtatttcccgaagctggggtcgcacggcaccaagcgccgcctcgttgagtac
tacttcgccgtggccgggggtccgatgctgacggcgctgcgtgaccggccgacgcacttg
cagcgcttcccggacggcgtcgacggcgagcagatctaccaaaagcggatcccgcggcac
cgccctgactacctgcagacgtgccgggtgacgtttccgtcggggcggatggctgatgcg
ctgaaggtgacccacccggcggcgatcgtatgggcggcgcagatgggcacaatcaccctg
cacccgtggcaagtgcgctgccccgacaccgagcaccccgacgaattgcgcatcgatcta
gatccgcaaccgggcaccggcttcgtggaggcgcgtacggtcgccgtcgatgtgctccgg
tccgtgctggacgacctcggtctggtcggttatccgaagacatccgggggtagagggatt
cacgtattcctgcgcatcgccaccgactgggacttcgtcgaggtgcgtcgggcgggcatt
gcgttggcccgggaagtcgagcgccgcgcaccggatgcggtgacgacgtcgtggtggaag
gaagaacggggcgcgcgtatcttcatcgacttcaaccaaaacgcccgcgaccgcaccatg
gcgtcggcctattcggtgcgtcctaccccgatcgcgacggtatcgatgccgttgacctgg
gaagagctggccggcgcggatcccgacgactacaccatgaccacggtgcccgagctggtg
aagatccgcgacgacccctgggccggcatggacgacgtggcccagtcgattgcaccattg
ctggacttggccgccgccgacgaggagcgcgggctcggtgacatgccgtatccgccgaac
tatccgaagatgccgggcgaacccaagcgggtgcagccgagccgggataccgacttgaag
gggggaaacacgtcgaagtaa

DBGET integrated database retrieval system