KEGG   Mycobacterium canettii CIPT 140060008: BN44_50418Help
Entry
BN44_50418        CDS       T02419                                 

Gene name
rbsK
Definition
Ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN44_50418 (rbsK)
Enzymes [BR:mcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BN44_50418 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2768063..2768944
Genome map
AA seq 293 aa AA seqDB search
MAPRVCVVGSVNMDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAAARAGAQVQFSG
AFGDDPAAAQLRAHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLVAPGANAHLTPV
PSAVANCDVLLTQLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSLQDLAAIADVVI
ANEHEANDWPSPPTHFVITLGVRGARYVGADGVFEVPAPTVTPVDTAGAGDVFAGVLAAN
WPRNPGSPAERLRALRRACAAGALATLVSGAGDCAPAAAAIDAALRANRHNGS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgggtgtgcgtggtaggcagcgtgaacatggacctgacgttcgtggtggac
gcgcttccgcgccccggcgagacggtgcttgcggcgtcgttgacccgaacgccaggcggg
aagggcgccaaccaggcggtggccgcagcgcgcgcaggcgcgcaggtacagttctccggt
gcattcggcgacgatccagccgccgcccagctgcgggcccacctgcgcgccaacgccgtt
ggactggacaggaccgtcacggtgcccggaccgagcgggacggcgattatcgtggtcgat
gccagcgccgagaacaccgtgctggtggcgccgggtgccaatgcacatctgactccggta
ccctcggccgtcgccaactgcgatgtactgttgacccagttggagattcctgttgcaacc
gcgctggcagccgcgcgggcagcccagtcggccgatgcggttgtcatggtcaacgcctcc
ccagccggccaggatcgaagctccttgcaggacttggccgctatcgccgacgtggtgatc
gccaacgagcatgaggcaaacgactggccgtcgccaccaacacatttcgtgatcaccctg
ggtgtgcgcggtgcccggtacgtcggcgcggacggggtgttcgaggtacccgccccaacg
gtaacgccagtggataccgccggcgccggcgacgtatttgccggggtccttgctgcgaat
tggccgcgcaacccaggttcgccggccgagcgactgcgcgcattgcggcgggcctgcgct
gcgggtgcgctggcaactttggtgtccggtgccggcgactgcgcaccggccgccgccgcg
atcgatgcggccctgcgagccaaccgccacaacggttcatga

DBGET integrated database retrieval system