KEGG   Mycobacterium canettii CIPT 140060008: BN44_50422Help
Entry
BN44_50422        CDS       T02419                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00330  Arginine and proline metabolism
mcq00332  Carbapenem biosynthesis
mcq01100  Metabolic pathways
mcq01130  Biosynthesis of antibiotics
mcq01230  Biosynthesis of amino acids
Module
mcq_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN44_50422 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BN44_50422 (proB)
Enzymes [BR:mcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BN44_50422 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CCK52425
Position
complement(2771917..2773047)
Genome map
AA seq 376 aa AA seqDB search
MRSPHRDAIRTARGLVVKVGTTALTTPSGMFDAGRLAGLAEAIERRMKAGSDVVIVSSGA
IAAGIEPLGLSRRPKDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLTAHDISMRV
QHTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSDID
GLYDCDPRKTADATFIPEVSGPADLDGVVAGRSSHLGTGGMASKVSAALLAADAGVPVLL
APAADAATALADASVGTVFAARPARMSARRFWVRYAAEATGALTLDAGAVRAVVRQRRSL
LAAGITAVSGRFCGGDVVELRAPDAAMVARGVVAYDASELATMVGRSTSELPGELRRPVV
HADDLVAVSAKQAKQV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtccgcatcgggacgcaatccggaccgcgcgcggccttgtcgtgaaggtcggg
accacggcgcttaccacaccgtccgggatgttcgatgccggccggctggccggactggcc
gaggcgatcgagcggcggatgaaggcgggttccgacgtcgtcatcgtgtcttcgggcgcc
atcgccgccggcatcgagccgctcgggctgtcccgtcgtcccaaagatctggcgaccaag
caggcggcggccagcgtcgggcaggtcgcgctggtgaactcgtggagcgcggcgttcgcc
cgctacggccgcacggtgggccaggtgctgctgaccgcgcacgacatttcgatgcgggtg
cagcacaccaacgcccaacgcacgctggatcggctgcgggcgttgcacgcggtggcgatt
gtcaacgagaacgacaccgtggccaccaacgagatccggttcggtgacaacgatcgactg
tctgcactggtggcgcacctggtcggcgccgacgctttggtgctgctgtcggacatcgac
ggcctctacgactgcgacccgcgcaaaaccgcggacgcgacgttcattccggaggtgtcc
gggccggcggatctggacggtgtggtcgccggccgcagtagccacctgggtactggcggc
atggcgtccaaggtgtcggcggcgctgttggccgccgacgccggggtgccggtactgctg
gcccccgcggccgacgccgcgaccgcgctcgccgacgcgtcggtgggcacggtgtttgcg
gcccggcccgcgcgtatgtcggcccggcggttctgggtgcgttatgccgccgaagcaacc
ggcgcactgactctcgacgccggtgcggtgcgcgctgtggtgcgacaacgccggtcactg
ctggcggcgggtatcaccgcggtgtccggccggttttgcggcggcgatgtggtcgaactg
cgtgcacccgacgcggccatggtagcccgcggggtggttgcctacgacgcgtccgagctg
gccaccatggtgggccggtccacctctgagctacccggcgagctgcgccgcccggtggtg
cacgccgacgatctggtcgcggtgtcggcgaagcaagctaagcaagtttag

DBGET integrated database retrieval system