KEGG   Mycobacterium canettii CIPT 140060008: BN44_60525Help
Entry
BN44_60525        CDS       T02419                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3415057..3416637
Genome map
AA seq 526 aa AA seqDB search
MNTSASPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQVLAALADENRH
RLITLGMTPVVNAQLDDPYCLNGVHHWLANWQLRAEEAASVRYARQSKSADYPSCTPEAL
RAFGIRECADAARALDDFATRWRHGGSPLLRGLIDAGTVELLGGPLAHPFQPLLAPRLRE
FALREGLADAQLRLGHRPKGIWAPECAYAPGMEVDYATAGVSHFMVDGPSLHGDTALGRP
VGKTDVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGRNVPSEQKA
PYDPKRADRAVDVHVADFVDVVRNRLLCESERIGRPAHVIAAFDTELFGHWWYEGPTWLQ
RVLRALPAAGVRVGTLSDAIADGFVGDPVELPPSSWGSGKDWQVWSGAKVADLVQLNSEV
VDTALTTIDKALAQTASLDGPLPRDHVADQILRETLLTVSSDWPFMVSKDSAADYARYRA
HLHAHATREIAGALAAGRRDTARRLAEGWNRADGLFGALDARRLPK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacgtccgcaagcccggtgcccggcctgttcacgcttgttctgcacactcacctg
ccctggctggcccaccacgggcgctggccggtcggcgaggaatggctctatcagtcgtgg
gcggcggcctacctgccgctgctgcaggtgctggccgcgctggccgacgagaaccggcac
cggttgatcaccctcgggatgacgccggtggtcaacgcccagctcgacgacccatactgc
ctcaacggtgtgcatcactggctggccaactggcagctgcgcgccgaagaggccgccagc
gtgcggtatgcccgtcagtcgaagtcggctgactatccgtcatgcacaccggaggcgttg
cgggcctttgggattcgcgaatgtgccgatgcggctcgcgcgctcgacgacttcgccacg
cggtggcggcacggcggcagcccgctgctgcgcggcctgatcgacgccggcacggtggag
ctgctcggtggcccacttgcccacccgttccagccgctgctcgcaccgcggctgcgcgag
ttcgcgctgcgcgaaggcctcgccgatgctcagctgcggctgggccaccgcccaaagggg
atctgggcgcccgaatgcgcctacgccccggggatggaggtcgactacgccaccgcgggg
gtcagtcacttcatggtcgatggcccgtcgctgcacggcgacaccgcgctgggccggccg
gtggggaaaaccgatgtggtcgccttcggtcgcgacttgcaggtcagctaccgggtgtgg
tcaccgaaatccggctaccccgggcacgccgcctaccgcgacttccacacctatgaccac
ctgaccggactcaaaccggccagggtcaccgggcgtaacgtgccgtcggagcaaaaggca
ccctacgatcccaagcgcgctgaccgcgccgtcgacgtccatgttgccgatttcgtcgat
gtggtgcgcaaccggctgctctgtgagtccgagcgcatcggccggcccgcccacgtgatc
gccgccttcgacaccgagttgttcggccactggtggtacgagggcccaacctggctgcaa
cgggtattgcgggccttacccgccgccggtgtccgggtgggcaccctgagcgatgcgatc
gccgacggattcgtcggcgacccggtcgaattgccacccagctcttggggctccggcaag
gactggcaggtgtggagcggtgccaaggtggctgatctggtccagctcaacagcgaagtg
gtcgataccgcgttgaccaccatcgacaaggcgctggcccagacggcatccctggacgga
ccgctgcctcgcgatcacgttgctgatcagatcctgcgcgagaccctgctcaccgtgtcc
agcgactggccgttcatggtgagcaaggactccgccgccgactacgcccgctatcgtgct
cacctgcacgcacacgccacccgggagatcgccggcgcgctggccgcgggccgacgcgac
accgcacggcggctcgccgaagggtggaaccgcgccgacggtctgttcggcgccctggac
gctcggaggctgccaaagtga

DBGET integrated database retrieval system