KEGG   Mycobacterium canettii CIPT 140060008: BN44_60575Help
Entry
BN44_60575        CDS       T02419                                 

Gene name
ligB
Definition
Putative ATP-dependent DNA ligase LigB (polydeoxyribonucleotide synthase [ATP]) (polynucleotide ligase [ATP]) (Sealase) (DNA repair protein) (DNA joinase) (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    BN44_60575 (ligB)
   03420 Nucleotide excision repair
    BN44_60575 (ligB)
   03430 Mismatch repair
    BN44_60575 (ligB)
   03450 Non-homologous end-joining
    BN44_60575 (ligB)
Enzymes [BR:mcq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BN44_60575 (ligB)
DNA repair and recombination proteins [BR:mcq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BN44_60575 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3461904..3463427
Genome map
AA seq 507 aa AA seqDB search
MLLHDVAITSMDVAATSSRLTKVARIAALLHRAAPDTQLITIIVSWLSGELPQRHIGVGW
AALRSLPPPAPQPALTVTGVDATLAKIGTLSGKGSQAQRAALVAELFSAATEAEQTFLLR
LLGGELRQGAKGGIMADAVAQAAGLPAATVQRAAMLGGNLAAAAAAGLSGAALDTFTLRV
GRPIGPMLAQTATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARL
PEVVEATLALPVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAGARATQPLSVFFF
DILHRDGTDLLEAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMA
KAPAARYLAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGGFVM
VGKTFKGMTDAMLDWQTTRFHEIAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGGLAL
RFARVVRYRADKDPAEADTIDAVRALY
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgctccttcacgacgtggccatcacctcaatggacgtggccgccacctcgtcgcggctg
accaaggtcgcgcgcatcgccgccctgttgcaccgcgccgcgccagacacacagctgatc
acgatcatcgtgtcgtggctctccggcgagctgccgcaacgccatatcggtgtcgggtgg
gcggcattgcggtccctaccgccgcccgcgccgcaaccggcgttgaccgtcaccggtgtc
gacgccaccctcgctaagatcggcactctatcgggcaaagggtctcaggcgcagcgcgcg
gcactcgttgcggaattgttctccgccgcaaccgaagctgagcaaacctttttgttgcga
ctgctcggcggtgaactgcgccagggcgcaaagggcgggatcatggccgatgcggtcgcc
caggccgccgggctcccggccgcgacggtccaacgcgccgcgatgctaggcggcaacctg
gcggcagcggcggcggccggcctgtccggcgcggcgctggacaccttcaccctgcgagtg
ggccgaccgataggcccgatgctggcacagaccgcgaccagcgtccatgatgcactcgaa
cgtcacggcggcacaaccattttcgaggctaaactagacggcgcgcgagtgcagatccac
cgggcaaacgaccaggtcaggatctacacccgaagcctggacgacgtcactgcccggctg
cccgaggtggtggaggcaacactggcactgccggtccgggatctagtggccgacggcgag
gcgatcgcgctgtgcccggacaaccggccgcagcgcttccaggtcaccgcatcacggttc
ggccgatcggtcgatgttgctggggcccgcgcgacgcagccactttcggtgttcttcttc
gacatcctgcatcgggatggtaccgacttgctcgaagcgccgaccaccgagcggctggcc
gccctggacgcactggtgccggctcggcaccgcgtggaccggctgatcacgtccgatcca
acggacgcggccaacttcctggatgcgacgctggccgccggccacgagggggtgatggcc
aaggcaccggccgctcgttaccttgcgggtcgccgcggagcgggctggctgaaggtcaag
ccggtgcacacactcgacttggtggtgctcgcggtggaatggggctcgggacgccggcgc
ggcaagctctccaatattcacctgggcgcacgcgatccggctaccggtggattcgtgatg
gtgggcaagaccttcaaaggaatgaccgacgccatgctggactggcagaccaccaggttt
cacgagatcgcggtgggtccgacagacggctacgtcgtccaacttaggcccgagcaggtg
gtcgaggtagccctcgacggcgtgcaaaggtcgtcgcgctacccgggcgggctggcattg
cggtttgcccgcgtggtgcgctaccgcgccgacaaggacccggccgaggccgacaccatc
gatgccgtgcgcgcgctctactga

DBGET integrated database retrieval system