KEGG   Moraxella catarrhalis BBH18: MCR_0019Help
Entry
MCR_0019          CDS       T01224                                 

Gene name
hemD
Definition
(GenBank) putative uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mct  Moraxella catarrhalis BBH18
Pathway
mct00860  Porphyrin and chlorophyll metabolism
mct01100  Metabolic pathways
mct01110  Biosynthesis of secondary metabolites
mct01120  Microbial metabolism in diverse environments
Module
mct_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MCR_0019 (hemD)
Enzymes [BR:mct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MCR_0019 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADG60293
UniProt: D5V9E0
Position
22862..23620
Genome map
AA seq 252 aa AA seqDB search
MMSTLLINTRPKHRGQAIRQMTGMPVIDLPLLDIQTLPMTETKASMMRAWLDHDYDVLVV
TSVESARRALEYLDKLHGGHHWQSKLPNAPIVAVGLATAKVLTDRGLPVVLPRVTNNEGM
LAMTEIRSLISGSRVLIWRGAGGRKLLHETLKARGVQIDVIRWYERFIPMDLMDNFQKNL
KIINEKADVFVIISSEMAYQAWRRLPHHRQYHYLALGERLKNIIHAYEPDVMVDELVTLE
PTEIYQVIHQNF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcaactttactcattaacacccgacccaagcaccgtgggcaagccattcgtcaa
atgacgggtatgccagtcattgatctgccgctgttagacatccagacgctgcccatgaca
gagaccaaagcatcgatgatgcgtgcatggcttgatcatgactatgatgtgcttgtggtg
accagcgttgagtcagcacggcgagcacttgaatatttagataagttgcatggtggccat
cattggcaatccaagttgcctaatgcacccattgttgctgttggtttggcaactgccaaa
gtattgactgatcgtgggctgcctgttgttttacctagggttactaataacgagggtatg
ctggcaatgactgagattcggtcgctgatatcaggcagtcgggttttgatttggcggggt
gctggtgggcgtaagctgttacatgagacattaaaagcacgaggcgttcagattgatgtc
attcgttggtatgagcgatttattcccatggatttgatggataattttcagaaaaattta
aaaataatcaacgaaaaagctgatgtctttgtcattattagtagcgaaatggcctatcaa
gcatggcggaggttgccgcatcatagacagtatcactatttggcactgggtgagcggctt
aagaatatcatccatgcttatgagcctgatgtgatggttgatgagcttgtgacgcttgag
cctactgaaatttaccaagtaattcaccaaaatttctga

DBGET integrated database retrieval system