KEGG   Moraxella catarrhalis: MCR_0067Help
Entry
MCR_0067          CDS       T01224                                 

Gene name
sdhD
Definition
succinate dehydrogenase subunit D (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mct  Moraxella catarrhalis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCR_0067 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCR_0067 (sdhD)
   00650 Butanoate metabolism
    MCR_0067 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MCR_0067 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74692..75045
Genome map
AA seq 117 aa AA seqDB search
MRNNSGIKSATGLTGSGSRDWILQRISAVVLAVYSVVMVGFFLFNDVNFESWQGFMLSLP
MKLFSLVAILSLVFHAWVGMWTVLTDYVKSSGLRLVIQSLVIIAVLVYLFWGVMIFW
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgagaaataattctggtattaaaagtgcgactggcttgacaggttcaggttcacgagat
tggattttacagcgtattagtgcggttgtcttagcagtttatagcgttgttatggtaggc
tttttcctattcaatgatgtgaattttgaaagctggcaaggctttatgctaagtctacca
atgaagctatttagcttggtggcgattttatcattggtatttcacgcatgggtgggcatg
tggacggttttgacggattatgtcaaatcatcaggtttgcgtttggtcatccaatctttg
gtcattatcgctgttttggtctatctgttttggggcgtgatgattttttggtaa

DBGET integrated database retrieval system