KEGG   Moraxella catarrhalis RH4: MCR_0072Help
Entry
MCR_0072          CDS       T01224                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mct  Moraxella catarrhalis RH4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCR_0072 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCR_0072 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MCR_0072 (sucB)
Enzymes [BR:mct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCR_0072 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81072..82310
Genome map
AA seq 412 aa AA seqDB search
MAEIKAPVFPESVQDGTIVEWHVAEGEAVSRDQLLAEVETDKVVLEIVAPDNGVITSIVK
NVDDTVLSAEVVAIFEAGASAPAGEAPSKDGELSKDEADKGTTIDPASVAAPVQPKDESA
TSEAEYKDHSPAVRKAAKETGVNPADVQGSGRGGRVTKSDMINPTLKGDNGQVIATAVGQ
RIEKREPMTRLRKRIAERLLSATQETAMLTTFNEVNMKPLMDLRAKYKDRFEKRHGVKLG
FMSLFVKAATEALKRFPAVNASIDGSDIIYHGYYDVGVAVSSDRGLVVPVLRDTDRMSMA
DVEAGIRDYATKARDGKLSIEEMTGGTFTITNGGVFGSLLSTPIINPPQTAILGMHAINE
RPMAVDGEVVILPMMYLALSYDHRLIDGKEAVQFLVTIKELIEDPSMLLLDL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattaaagcccctgtatttccagaatcagtacaagatggtacgatcgttgaa
tggcatgttgctgaaggtgaagccgttagccgtgaccaacttttggctgaagttgaaact
gataaagtagttttggagattgttgcgcctgataatggtgtgattaccagtatcgttaag
aatgtggatgataccgtattatcggcagaagtggttgcaatttttgaggcgggtgcgtca
gcaccagcaggtgaagcaccatcaaaagatggtgagctgtcaaaagacgaagctgataaa
ggcacaaccattgatccagcatcggttgcagcaccagtacaaccaaaagatgaatcagca
acatcagaagctgaatataaagatcacagcccagcagtcagaaaagccgccaaagaaact
ggtgttaatcctgctgatgttcaaggctcagggcgtggcggtcgggtgaccaaatctgac
atgattaacccaaccctaaaaggtgataatggtcaagtgattgccacagctgttggtcag
cgtatcgaaaagcgtgagccgatgactcgtctgcgtaagcgtatcgctgaacgactattg
tcagccactcaagaaactgcgatgttgacgacatttaatgaagttaatatgaagccgttg
atggatttgcgtgccaaatacaaagatcgttttgagaagcgtcatggcgttaaacttggc
tttatgtcattatttgttaaggctgccaccgaagccttgaagcgtttcccagcagtgaat
gcatcgattgatggtagcgatatcatttatcatggctattatgatgtgggtgtggcggta
tcaagtgatcgtggcttggttgtgccagtgctgcgtgatactgatcgcatgagtatggca
gatgttgaggcgggcattcgtgattatgcaactaaggcgcgtgatggtaaactgagcatt
gaggagatgactggcggtacatttaccattaccaatggcggtgtgtttggttcattgtta
tcaacaccaatcatcaacccaccacaaactgcaattttgggcatgcatgcaatcaatgag
cgtccaatggcagttgatggcgaagttgttatcctaccgatgatgtatcttgcgttatct
tatgatcaccgtttgattgatggcaaagaagcagttcaattcctagtgacaattaaggag
ttgattgaagatccatcaatgctactacttgacctataa

DBGET integrated database retrieval system