KEGG   Moraxella catarrhalis: MCR_0091Help
Entry
MCR_0091          CDS       T01224                                 

Gene name
fadB
Definition
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase FadB (EC:4.2.1.17)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
mct  Moraxella catarrhalis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCR_0091 (fadB)
   01212 Fatty acid metabolism
    MCR_0091 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MCR_0091 (fadB)
   00650 Butanoate metabolism
    MCR_0091 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    MCR_0091 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    MCR_0091 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCR_0091 (fadB)
   00310 Lysine degradation
    MCR_0091 (fadB)
   00380 Tryptophan metabolism
    MCR_0091 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCR_0091 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCR_0091 (fadB)
   00281 Geraniol degradation
    MCR_0091 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MCR_0091 (fadB)
Enzymes [BR:mct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MCR_0091 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCR_0091 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MCR_0091 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     MCR_0091 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
103601..105754
Genome map
AA seq 717 aa AA seqDB search
MIYQGKNIQVDFFDQTQGIVQFHFNATDESVNKFDRKTTQEYQEAVTVLENRDDIQGLIV
TSGKSVFIAGADITEFTEYFSRSKDEIEAWLLDINHIFNRFEDLPFPKVAAINGAALGGG
CEMALVCDYRVAGISAQIGLPETKLGIFPGFGGSVRLPRLIGIDNALEAIATGKAYRPDE
ALKLGLVDAVVADELLEQAAADLVKKCLLGKFDWQAKRQEKQVPVKLNQLEQAMAFNSAK
GVIFAKANPKHYPAVAIALETIEKHANLNRDDAIALEAKGFTKAATTPQAAALVGLFLND
QTVKKLAKKHSQNAQTIKQAAVLGAGIMGGGIAYQAAVKGLPIIMKDIQAKQLDLGMNEA
GKLLSKEVLRGKSTPAKMAQTLSHIRPTLNYGDFGEVDIVIEAVVENPTIKEAVLSEVEG
LVKQETILASNTSTISITRLANALKRPENFVGMHFFNPVHRMPLVEVIRGEKTSDIAIAT
TVALAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKEGADFVSIDKTMEKFGWPMGP
AYLLDVVGMDTGVHAAKVMAEGFPDRMKPDYKGATQLMFEHERLGQKNGVGFYQYETDKR
GKPKKIADSTTYELLNLVQTGDQTFDEQEIIDRMMIAFCNETVRCLEDNIVASPAEADMA
MIMGVGFPPFRGGPCRYIDQIGVANYVALCDKYAYLGKAYEAPAKLRDMAQNGETFY
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaaggaaaaaatattcaggtcgatttttttgaccaaacacaaggtatcgtg
cagtttcattttaatgccactgatgaaagcgttaataaatttgatcgcaaaaccactcaa
gaatatcaagaagcggtaacagtacttgaaaaccgtgatgatattcaaggcttaattgtc
acttcaggtaaatcggtgtttattgctggtgcggatattactgagtttaccgaatatttt
agtcgctctaaagatgaaattgaggcatggcttttggatatcaatcatatttttaatcgc
tttgaggatttgcccttcccaaaagtggcggcgattaatggtgcagcgttaggcggtggc
tgtgagatggctttggtatgcgattaccgtgtggcgggtatttctgcccaaattggtttg
cctgaaactaagcttggtatttttccaggttttggtggttcagtgcgtctgccacgcctg
attggcattgataacgcccttgaggccattgcgacaggtaaggcttatcgacctgatgaa
gcacttaaattgggattggttgatgcggtggtggctgatgagctgcttgagcaggcagcg
gctgatttggtcaaaaaatgcttattaggcaagtttgattggcaggcgaagcgtcaagaa
aaacaagtaccagttaagctcaatcagctggagcaggcaatggcatttaattcggctaag
ggtgtcatttttgccaaagccaatccaaaacattatcctgcggtggcgattgcccttgag
accatcgaaaaacacgccaatttaaaccgtgatgatgcgattgcccttgaagccaaaggt
tttacaaaagctgcaacaaccccacaagcggccgccttggtcggcttatttttaaatgac
caaacagttaaaaaacttgccaaaaagcacagtcaaaatgcacaaaccatcaagcaagca
gctgtacttggtgcaggtatcatgggtggcggtatcgcttatcaggcagcggtcaagggc
ttgccaattattatgaaagacattcaagccaagcagttagaccttggcatgaatgaagct
ggtaaactgttatcaaaagaggttttgcgtggtaaatcaacgccagctaagatggctcaa
accttaagccacattcgcccaaccttaaactatggcgattttggtgaagttgatattgtg
attgaggcggtcgttgaaaatcctacaatcaaagaagcggtattgtctgaggtggagggc
ttggtaaaacaagagaccattttggcctcaaatacctcaacgatttctatcactcgcttg
gcgaatgccctaaaacgccccgaaaactttgtgggtatgcacttttttaacccagtacat
cgcatgccattagttgaggtgattcgtggcgagaagaccagcgatatcgccattgcaaca
acggttgcattggcacaaaaaatgggcaaaactccaattgtcgtcaatgactgcccagga
tttttggtgaatcgtgtgttatttccttattttggtgcgttcgatttgctggtcaaagaa
ggtgccgattttgttagtattgataagaccatggaaaaatttggctggccgatgggtcct
gcgtatcttttggatgttgtgggtatggatacaggcgtgcatgctgccaaggtgatggca
gagggtttccctgatcgtatgaagccagattataaaggtgcaacgcagctgatgtttgag
catgagcgtttgggtcaaaaaaatggtgttggtttttatcaatatgaaactgataagcgt
ggcaaacctaaaaaaattgccgatagtaccacttatgagctgttaaacttggttcaaact
ggcgatcagacttttgatgagcaagaaattatcgaccgcatgatgattgcattttgcaat
gaaaccgtacgctgcttggaagataatatcgtcgcaagccctgctgaagctgatatggcg
atgattatgggcgtaggtttcccaccatttcgtggcggcccttgccgatatatcgaccaa
atcggtgtcgcaaactatgttgcattgtgcgataagtacgcatatttaggtaaggcatat
gaagcacctgccaaattgcgtgatatggctcaaaatggcgagactttttactaa

DBGET integrated database retrieval system