KEGG   Moraxella catarrhalis BBH18: MCR_0091Help
Entry
MCR_0091          CDS       T01224                                 

Gene name
fadB
Definition
(GenBank) enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
mct  Moraxella catarrhalis BBH18
Pathway
mct00071  Fatty acid degradation
mct00280  Valine, leucine and isoleucine degradation
mct00281  Geraniol degradation
mct00310  Lysine degradation
mct00362  Benzoate degradation
mct00380  Tryptophan metabolism
mct00410  beta-Alanine metabolism
mct00640  Propanoate metabolism
mct00650  Butanoate metabolism
mct00903  Limonene and pinene degradation
mct00930  Caprolactam degradation
mct01040  Biosynthesis of unsaturated fatty acids
mct01100  Metabolic pathways
mct01110  Biosynthesis of secondary metabolites
mct01120  Microbial metabolism in diverse environments
mct01130  Biosynthesis of antibiotics
mct01200  Carbon metabolism
mct01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MCR_0091 (fadB)
   00650 Butanoate metabolism
    MCR_0091 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    MCR_0091 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    MCR_0091 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCR_0091 (fadB)
   00310 Lysine degradation
    MCR_0091 (fadB)
   00380 Tryptophan metabolism
    MCR_0091 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCR_0091 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCR_0091 (fadB)
   00281 Geraniol degradation
    MCR_0091 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCR_0091 (fadB)
   00930 Caprolactam degradation
    MCR_0091 (fadB)
Enzymes [BR:mct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MCR_0091 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCR_0091 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MCR_0091 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     MCR_0091 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ADG60365
UniProt: D5V9L2
Position
103601..105754
Genome map
AA seq 717 aa AA seqDB search
MIYQGKNIQVDFFDQTQGIVQFHFNATDESVNKFDRKTTQEYQEAVTVLENRDDIQGLIV
TSGKSVFIAGADITEFTEYFSRSKDEIEAWLLDINHIFNRFEDLPFPKVAAINGAALGGG
CEMALVCDYRVAGISAQIGLPETKLGIFPGFGGSVRLPRLIGIDNALEAIATGKAYRPDE
ALKLGLVDAVVADELLEQAAADLVKKCLLGKFDWQAKRQEKQVPVKLNQLEQAMAFNSAK
GVIFAKANPKHYPAVAIALETIEKHANLNRDDAIALEAKGFTKAATTPQAAALVGLFLND
QTVKKLAKKHSQNAQTIKQAAVLGAGIMGGGIAYQAAVKGLPIIMKDIQAKQLDLGMNEA
GKLLSKEVLRGKSTPAKMAQTLSHIRPTLNYGDFGEVDIVIEAVVENPTIKEAVLSEVEG
LVKQETILASNTSTISITRLANALKRPENFVGMHFFNPVHRMPLVEVIRGEKTSDIAIAT
TVALAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKEGADFVSIDKTMEKFGWPMGP
AYLLDVVGMDTGVHAAKVMAEGFPDRMKPDYKGATQLMFEHERLGQKNGVGFYQYETDKR
GKPKKIADSTTYELLNLVQTGDQTFDEQEIIDRMMIAFCNETVRCLEDNIVASPAEADMA
MIMGVGFPPFRGGPCRYIDQIGVANYVALCDKYAYLGKAYEAPAKLRDMAQNGETFY
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaaggaaaaaatattcaggtcgatttttttgaccaaacacaaggtatcgtg
cagtttcattttaatgccactgatgaaagcgttaataaatttgatcgcaaaaccactcaa
gaatatcaagaagcggtaacagtacttgaaaaccgtgatgatattcaaggcttaattgtc
acttcaggtaaatcggtgtttattgctggtgcggatattactgagtttaccgaatatttt
agtcgctctaaagatgaaattgaggcatggcttttggatatcaatcatatttttaatcgc
tttgaggatttgcccttcccaaaagtggcggcgattaatggtgcagcgttaggcggtggc
tgtgagatggctttggtatgcgattaccgtgtggcgggtatttctgcccaaattggtttg
cctgaaactaagcttggtatttttccaggttttggtggttcagtgcgtctgccacgcctg
attggcattgataacgcccttgaggccattgcgacaggtaaggcttatcgacctgatgaa
gcacttaaattgggattggttgatgcggtggtggctgatgagctgcttgagcaggcagcg
gctgatttggtcaaaaaatgcttattaggcaagtttgattggcaggcgaagcgtcaagaa
aaacaagtaccagttaagctcaatcagctggagcaggcaatggcatttaattcggctaag
ggtgtcatttttgccaaagccaatccaaaacattatcctgcggtggcgattgcccttgag
accatcgaaaaacacgccaatttaaaccgtgatgatgcgattgcccttgaagccaaaggt
tttacaaaagctgcaacaaccccacaagcggccgccttggtcggcttatttttaaatgac
caaacagttaaaaaacttgccaaaaagcacagtcaaaatgcacaaaccatcaagcaagca
gctgtacttggtgcaggtatcatgggtggcggtatcgcttatcaggcagcggtcaagggc
ttgccaattattatgaaagacattcaagccaagcagttagaccttggcatgaatgaagct
ggtaaactgttatcaaaagaggttttgcgtggtaaatcaacgccagctaagatggctcaa
accttaagccacattcgcccaaccttaaactatggcgattttggtgaagttgatattgtg
attgaggcggtcgttgaaaatcctacaatcaaagaagcggtattgtctgaggtggagggc
ttggtaaaacaagagaccattttggcctcaaatacctcaacgatttctatcactcgcttg
gcgaatgccctaaaacgccccgaaaactttgtgggtatgcacttttttaacccagtacat
cgcatgccattagttgaggtgattcgtggcgagaagaccagcgatatcgccattgcaaca
acggttgcattggcacaaaaaatgggcaaaactccaattgtcgtcaatgactgcccagga
tttttggtgaatcgtgtgttatttccttattttggtgcgttcgatttgctggtcaaagaa
ggtgccgattttgttagtattgataagaccatggaaaaatttggctggccgatgggtcct
gcgtatcttttggatgttgtgggtatggatacaggcgtgcatgctgccaaggtgatggca
gagggtttccctgatcgtatgaagccagattataaaggtgcaacgcagctgatgtttgag
catgagcgtttgggtcaaaaaaatggtgttggtttttatcaatatgaaactgataagcgt
ggcaaacctaaaaaaattgccgatagtaccacttatgagctgttaaacttggttcaaact
ggcgatcagacttttgatgagcaagaaattatcgaccgcatgatgattgcattttgcaat
gaaaccgtacgctgcttggaagataatatcgtcgcaagccctgctgaagctgatatggcg
atgattatgggcgtaggtttcccaccatttcgtggcggcccttgccgatatatcgaccaa
atcggtgtcgcaaactatgttgcattgtgcgataagtacgcatatttaggtaaggcatat
gaagcacctgccaaattgcgtgatatggctcaaaatggcgagactttttactaa

DBGET integrated database retrieval system