KEGG   Moraxella catarrhalis BBH18: MCR_0352Help
Entry
MCR_0352          CDS       T01224                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mct  Moraxella catarrhalis BBH18
Pathway
mct00230  Purine metabolism
mct01100  Metabolic pathways
Module
mct_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MCR_0352 (gmk)
Enzymes [BR:mct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MCR_0352 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_16 AAA_18 AAA_33 AAA_24 MobB AAA_22 IPPT AAA_19 cobW AAA_25
Motif
Other DBs
NCBI-ProteinID: ADG60624
UniProt: D5VAC1
Position
complement(368490..369119)
Genome map
AA seq 209 aa AA seqDB search
MAGTLFIITAASGTGKTSLVKELLKCTKGLCVSISHTTRQPRPGEINGIHYHFIDTASFQ
SLIQASEFLEYAQVFDHYYGTSKQAVIDLLAQGIDVILEIDWQGALQVKAQFDQAVMIFI
LPPTRQALAERLSNRGQDSQEVIKKRLAGSLDEIRQYDQFDYVVINDRFEMALDDLQTII
KSHRLTLHAQQARHAALIAALFDDTPTYP
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcacgctttttatcatcaccgccgcatcaggcacaggcaaaacctcactggtc
aaagaactgctcaaatgtaccaagggcttatgtgtgagcatctcgcataccacacgccaa
cctcgcccaggcgaaattaacggtatacactatcattttattgacaccgcaagctttcag
tcattaattcaagcatctgagtttttagaatatgcccaagtatttgaccattattatggc
acatcaaaacaagccgtcatagatttattagcccaagggattgatgtcatcttggaaatt
gattggcaaggtgcattacaggtcaaagcacaatttgaccaagcggtgatgatttttatc
ctaccgcccactcgccaagcgttggcagagcgattatcaaaccgtggtcaagacagccaa
gaggtcatcaaaaaacgcttggcaggctcactggatgaaatacgccaatacgatcaattt
gattatgtggtgattaatgatcgctttgagatggcgttagatgatttacaaacgattatt
aagagtcaccgcctgacgctacatgcacagcaggctcgccatgctgctttgattgctgca
ttatttgatgatacgccaacctatccatga

DBGET integrated database retrieval system