KEGG   Moraxella catarrhalis: MCR_0361Help
Entry
MCR_0361          CDS       T01224                                 

Definition
type III restriction-modification system restriction endonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mct  Moraxella catarrhalis
Brite
Enzymes [BR:mct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     MCR_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377506..380100
Genome map
AA seq 864 aa AA seqDB search
MQIQYEHLDYQKQAIDSIVDLFQGEITHHQDDFSLSDKDNMRVIANELSLSKDDIFNNLK
NIQTQNQLSLSDKLDNLYFSVEMETGTGKTFVYLNTIFELYQRYGWRKFIIVVPSVAIRE
GVLQTLNSTKAHFKDEFNSPIYHYGEYSGQKTNALKHFATSTNIEILVMNIQSFEKESNI
INQQRENGVLMELIQATNPIIIIDEPQNISSDKRKNAIENLNPLFTVGYSATHKEIINKV
YSLNPVQAFEKNLVKQIVVNSVISQDKNNAFIELKEITNKSGLKAKIIFDISEKQQLKRK
AITVKLGDDLYEKSKQNPNYQGFIITGIDLENQMIKFSNGIEIARGVNMDCLRDEIMKQQ
IHYTIKEHLKHEKELNKDGIKVLSLFFIDKVENYRTNAQGELGKFYEWFEELYELETKQS
ASGVHKGYFSQDKKGNAKNSNGTTKDDNDAYELIMKDKERLLSLDEPVRFIFSHSALKEG
WDNPNVFQICTLNETTSVIKKRQEIGRGLRLPVNQKGERIYDEKVNILTVIPNESYEQFA
NSLQQEYIDDCGIKFEKSYLKNAKNERTVTYRFDAFTDPLFLQIWERIRHKTSYRVQFDS
DELIDNASQKIHVMPKIDTPKIEIKKARMVQNSETGIETQEIFSQSEHIQTKFVIPDILK
VLQQKTGLTRNTLVQILQQSGRIDEVKSNPQRFIETVAEIINDELYDLMKNGIYYQKLDK
VYEQSLFKTYKIYANQYTFNVNKMDKTIYNGVLDLDSNTENQFATDCENYDEQVAFYFKL
PKKFKIPTPIGNYNPDWAVVIKKNGEQVYFIAETKNTGDKSIQDGVVVDKLKWEERFKIA
CAKRFFEINDEVDYQVVQKINELT
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccaatatgaacatttagattatcaaaaacaggcgattgatagtatcgtagat
ttatttcaaggcgaaattacgcatcatcaagatgattttagcttgtcggacaaagacaat
atgcgtgtgattgccaatgaattatctttatccaaagatgatatttttaataatttaaaa
aatatccaaacgcaaaatcagctttctttatctgataaattggataatttgtattttagt
gtagaaatggaaacgggtacgggcaaaacttttgtttatttaaataccatttttgagctt
tatcaacgctatggctggcgaaaatttatcattgttgtgccaagtgtcgccattcgtgaa
ggtgtattacaaactttaaatagcacaaaagcccattttaaagatgaatttaattcgcca
atttatcattatggtgaatatagcggtcaaaaaaccaatgcattaaaacattttgcgaca
agtacaaacattgaaattttggtgatgaacattcaatcttttgaaaaagaaagcaatatc
attaatcaacagcgagaaaatggcgtattaatggagttaatccaagcaacgaatccaatc
attattattgatgaaccacaaaatatcagcagtgataaacgcaaaaatgccattgaaaat
ttaaatccattatttacggttggatattcggcaacgcataaagaaattatcaataaagta
tacagcctaaatcctgtacaggcatttgaaaaaaatttggtaaaacaaattgtcgttaat
tcggtgatatcacaagataaaaataatgcctttattgaactaaaagaaatcacaaacaaa
agcggtttgaaagccaaaataatatttgatattagcgaaaaacagcaattaaaacgcaaa
gcaattaccgttaagctgggcgatgatttatatgaaaaatcaaagcaaaaccccaactat
caaggatttataattacaggcattgatttagaaaaccaaatgattaaattctctaatggt
atcgaaattgcccgtggtgtaaatatggattgtcttagagatgaaataatgaaacagcag
attcattatactattaaagagcatttaaagcatgaaaaggagttaaataaagacggcata
aaagtattatcactgttttttattgacaaggtagaaaattatcgcaccaatgcacaaggt
gaattggggaaattttatgagtggtttgaagaattatacgaattagaaaccaaacaatca
gctagtggcgtacataaaggctattttagccaagacaaaaaaggcaatgctaaaaacagc
aatggtaccaccaaagatgataatgatgcctatgagctgattatgaaagataaagagcgg
ttattgtcgcttgatgagcctgtgcgatttatttttagtcattcggcattaaaagagggg
tgggataatcccaatgtttttcaaatttgtactttgaatgaaaccacatctgtaattaaa
aaacgccaagaaattgggcgtggacttcgtttacctgtgaatcaaaaaggcgagcgaatt
tatgatgaaaaagtcaatattttgaccgtgattcccaatgaaagttatgagcaatttgcc
aacagtttgcaacaagaatatattgatgattgtggcattaaatttgaaaaatcttatctt
aaaaatgccaaaaatgaacgcacggtaacttatcgttttgatgcgtttaccgacccatta
tttttacaaatttgggagcgtattcgccataaaaccagctaccgtgtacaatttgatagc
gatgaattgattgacaatgccagtcaaaaaatccatgtcatgccaaaaattgacacacca
aaaattgaaattaaaaaagcaaggatggtgcaaaacagtgaaacaggcatagaaacgcaa
gagattttttctcaaagcgaacatattcaaacgaagtttgtgatacctgatattttaaaa
gtattgcaacaaaaaacaggtttaactcgcaatacattggtacagattttacagcaatct
ggtagaattgatgaagttaagagcaatccacaacgctttattgaaactgtagcagaaatc
atcaatgatgaattgtacgatttgatgaagaatggtatctattatcaaaaattggataaa
gtgtacgaacaaagtttatttaagacttataaaatttatgccaatcaatatacttttaat
gtaaataaaatggataaaaccatttataatggtgtgttggatttagattcaaataccgaa
aatcaatttgcaacagattgtgaaaattatgatgagcaagtggcattttattttaaatta
cccaaaaaatttaaaatcccaacgccgattggtaattacaacccagattgggcggtggtt
ataaaaaagaatggcgagcaggtttattttattgctgaaaccaaaaatacaggcgataaa
tccattcaagatggggtggtggttgataaattgaagtgggaagagcggtttaaaattgcg
tgtgcaaaacgattttttgaaataaatgatgaagtggattatcaagtggtacaaaagatc
aatgaattgacctaa

DBGET integrated database retrieval system