KEGG   Moraxella catarrhalis: MCR_0449Help
Entry
MCR_0449          CDS       T01224                                 

Definition
delta-9 acyl-phospholipid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mct  Moraxella catarrhalis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mct01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mct01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(464072..465250)
Genome map
AA seq 392 aa AA seqDB search
MSIERNSEAFEQAPINWVPAIVLLSTLFLAITIVPWYLWTHGVGMGVWVAFAILMAWTGL
SITAGYHRLWSHKSYEAHPVVKYILLLGATLAVESSVFDWCSGHRSHHRHVDDEYDDPYS
SRRGFWFSHMGWMLRKYPSGQYDYKNIPDLKKDKLLALQHKYYGFWVIATNVVILAMIGW
ITGDMLGTFLVAGLLRLVLTHHFTFFINSLCHMFGTRPYTDENTARDNGLLAIVTWGEGY
HNYHHYFQYDYRNGVKWWQYDPTKWIIGLLAKVGLASNLKRVDDLTIKHAELTMQFKRAQ
ERIVTGGEPSLDERLAAFKERISAEYDEFTKTVEEWHTLKAKAIELKRAELADRLNEADE
KLKAQLAQIETKILEQSKRVEQAYLQLKGKAI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgagcgtaattctgaagcgtttgagcaagcacccatcaactgggtacctgcc
attgtgctgttatccaccttgtttcttgccattactatcgtgccttggtatctatggacg
catggtgtgggcatgggcgtttgggtggcttttgctattttaatggcttggacgggtctg
tctatcactgctggctaccatcgtttgtggtcacataaatcctatgaagcccatcctgtt
gtcaaatatattttattacttggtgcgactttggcggttgaaagctcagtatttgactgg
tgttcagggcatcgctcacaccatcgccatgttgatgatgaatatgacgacccgtattct
tctcgtcgtggtttttggtttagccacatgggctggatgctacgcaaatacccaagcggt
caatatgattacaaaaatatccccgacctaaaaaaagataagctacttgccctacaacac
aagtattatggtttttgggtaattgccactaatgttgttattctagcgatgattggctgg
atcacaggggatatgctgggtacatttttagttgcaggtcttctacgcttggtattgacg
catcattttaccttttttatcaactcgctgtgccatatgtttggtacacgcccttatacc
gatgagaataccgcacgggacaatggcctacttgccatcgtgacttggggtgaaggttat
cataattatcatcactattttcaatatgactaccgtaatggcgtcaaatggtggcaatat
gacccaaccaaatggatcatcggtctgcttgccaaagtaggcttggccagtaatttaaag
cgtgtcgatgatttgaccatcaaacatgcagagctgaccatgcagtttaaacgcgcccaa
gaacgcatcgtaacagggggcgaaccaagtttagatgagcgtttggccgcctttaaagag
cgtatcagtgccgagtatgatgaatttaccaaaacggttgaagaatggcataccctaaag
gccaaagcgattgagctaaagcgtgcagaattagctgaccgattaaatgaagcagatgaa
aagctcaaagcacagcttgcccaaattgaaactaaaatcttagagcaaagtaagcgtgtt
gaacaggcatatctacaactcaaaggtaaagccatctga

DBGET integrated database retrieval system