KEGG   Moraxella catarrhalis BBH18: MCR_0489Help
Entry
MCR_0489          CDS       T01224                                 

Definition
(GenBank) protein-disulfide isomerase-like protein (EC:5.3.4.1)
  KO
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mct  Moraxella catarrhalis BBH18
Brite
Enzymes [BR:mct01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MCR_0489
Chaperones and folding catalysts [BR:mct03110]
 Protein folding catalysts
  Protein disulfide isomerase
   MCR_0489
Secretion system [BR:mct02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   MCR_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(508130..508933)
Genome map
AA seq 267 aa AA seqDB search
MRQIFMHRLLPPTLMASFLLLSACSSGNSHAKDTSNASQPTTQTSSQSDTTLVKTLQDNL
TQAGVDITVTNALPTTMPDIYWVSFENAPAMFTDKSGEYLIQGQIVKLSGDYPTDITADI
QSSLAKETLAKANTDDMIIYPATSQHKASIYVFSDPTCHYCRMLHKDIKQLNAGGIEVRY
LAWPRSEQDIPLTEAIWCSQDRKAALTAAKLGQTVHAKHCKNPVQEHLALGRSLGVSGTP
AVFAESGRQIGGYMPAKDLIHTAIEQR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaatttttatgcaccgattattaccgccaacactgatggcaagctttttatta
ttaagcgcctgcagctctggcaattctcatgccaaagatacctctaatgccagccagcca
acaacccaaacttcttctcaaagcgataccacgcttgtcaagacgctccaagataatttg
acccaagcaggggttgatatcactgtgacaaatgccctgccaacaaccatgcctgatatc
tattgggtcagctttgaaaatgcccctgcaatgttcacagataaatcgggtgaatattta
attcaagggcaaattgtcaaattaagtggtgattatccgacagatattaccgctgacatt
cagtcatctttggccaaagaaaccttagccaaagccaatactgatgatatgattatttac
cctgcaaccagtcagcataaagcatctatttatgtttttagcgacccaacttgccactac
tgccgaatgctacacaaggatatcaagcaactcaatgctggcggtattgaggtgcgttat
ttggcgtggccacgctcagaacaagacataccgctcaccgaagcaatttggtgcagccaa
gaccgaaaagcagccttaacagcagctaagcttggtcaaactgtccatgccaagcattgt
aaaaaccctgttcaagaacatttggcattagggcgtagtttgggcgtatcaggcacgcct
gctgtttttgccgaatctggcaggcagattggtggctatatgcctgccaaagatctcatc
catactgccattgaacaacgataa

DBGET integrated database retrieval system